KEGG   Cyprinus carpio (common carp): 109057974
Entry
109057974         CDS       T05134                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00230  Purine metabolism
ccar00240  Pyrimidine metabolism
ccar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109057974
   00240 Pyrimidine metabolism
    109057974
Enzymes [BR:ccar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     109057974
SSDB
Motif
Pfam: dNK AAA_18 AAA_28 Thymidylate_kin AAA_33 AAA_17
Other DBs
NCBI-GeneID: 109057974
NCBI-ProteinID: XP_018930743
Position
Unknown
AA seq 225 aa
MSPIAKRACPSPLNDSLEKRLKRISIEGNIAAGKSTFVRLLDEHDREWEVVPEPIARWCN
VQTHHNEHEELTDSQKSGGNVLQMMYEKPERWAYTFQSYACMSRVRSQIKSTNGKLREAE
NPVQFFERSVYSDRYIFASNLYESECVNETEWAIYQDWHSWLHKQFGKHIELDGIIYLRA
KPERCLERLHLRGRDEEQGIPLEYLEKLHYKFVKSGGTKVASYDE
NT seq 676 nt   +upstreamnt  +downstreamnt
atgtctcccattgccaaaagagcctgtcccagtcctctgaacgacagtctggagaaaaga
ctgaaacgcatctccattgaaggaaacattgccgcgggtaaatccacttttgttcgcctg
ctggatgaacatgatcgagaatgggaggtagtaccggaacccatcgctagatggtgcaat
gtacaaactcaccacaacgagcacgaggagttgactgactctcagaagagcggagggaac
gtgctgcagatgatgtacgagaagcccgagcgctgggcctacaccttccagagctacgcc
tgcatgagccgcgtccgctcgcagatcaaatccaccaacgggaaactgcgagaggccgag
aatcccgtgcagttcttcgaacgatccgtgtacagtgacaggtacatctttgcctctaac
ctctatgaaagcgagtgtgtgaatgaaaccgagtgggcgatctatcaggactggcacagc
tggctgcataagcagtttgggaagcacatcgagctggacggcatcatttacctgcgggca
aaaccagaaaggtgtttggagcgattgcatttgagaggaagagacgaggaacagggaatt
ccattggaatatctggagaaactccactataaatttgtaaaaagtggcggaactaaagtt
gcatcttatgatgagg

DBGET integrated database retrieval system