KEGG   Cyprinus carpio (common carp): 109059103
Entry
109059103         CDS       T05134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: endoplasmic reticulum aminopeptidase 1-like
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ccar01002]
    109059103
Enzymes [BR:ccar01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     109059103
Peptidases and inhibitors [BR:ccar01002]
 Metallo peptidases
  Family M1
   109059103
SSDB
Motif
Pfam: ERAP1_C Peptidase_M1 DUF3458_C
Other DBs
NCBI-GeneID: 109059103
NCBI-ProteinID: XP_018931849
Position
Unknown
AA seq 686 aa
MLFAQSWCLCCFTFAVLFCGLVVGNHADTNALPFPWDKIRLPETVKPQHYDLLIHPNLTS
MTFTGVQKTVQLPLIIPYHLRTVEMADGLLEDQFDTTVKMSTYLVAFIVSDFQSISKKSQ
HGVEISVYTVPEKISQAEYALSTAVTLLDFYDDYFDIPYPLPKHDLAAIPDFQSGAMENW
GLSTYRESGLLFDPEKSSSSDKLGITKVIAHELAHQVLTHLQTPKGACILNMLRDFLTPE
AFKYGIIHYLKTHSYQNTVNAHLWESLTNICTSDELDSGRLKLDGFCSKNRAESPASQKW
FMEDSVDVRAIMDTWTLQEGFPLITVEVKGQEVTLKQERFLREANSSKTSKTSSFLWQVP
LTYITSHSSAMQXFLLKSEKDVLYLPEKVDWIKFNVDLRGYYIVHYESGGWDALINQLQQ
NHSVFSSNDRASLIHDIFQLVSIEKIPLDKALNLSLYLSKESEIMPVTQGFNELVPLYKL
MEKRNMEELENQLKGHLVKLFKTLIDRQSWSDDGSVSERMLRNYLLLFACVRRYPSCIST
ATQLFQQWKESDGKMWLPTDISLVVYTEGARTDEGWDFLLEKYKRSVSPSEKWMIKAALS
YTPLTHKLQWLLERSIEGEIMKTQDLPSLVITVSKNPKGFKLAWDFLKTNWGKLVKKFDL
GSSAISRMAVGVTDQYSTREMLHEVL
NT seq 2061 nt   +upstreamnt  +downstreamnt
atgctcttcgcacagtcttggtgtttatgctgctttacatttgcagttttattctgtggc
cttgttgttggtaaccatgcagacacaaatgccttgccttttccctgggataagataaga
ttgccagaaacagtgaaaccccagcactatgacctcctgatacaccccaacttgacctcc
atgaccttcaccggggtccaaaaaactgtgcagctgcctttaatcataccgtatcatctg
agaactgtagaaatggccgacgggctgctcgaggatcagtttgacacgacggtgaagatg
agcacctacctggtggccttcatcgtctccgatttccagtccatcagtaaaaaaagccag
catggagtcgagatatccgtgtatactgttcccgagaagatcagtcaggcggaatatgct
ctcagcaccgccgtcacactgctggacttttatgatgattattttgacatcccgtatcca
cttcccaaacacgatcttgcagcgatcccagatttccagtcaggtgctatggagaactgg
ggcctgtcgacttacagagagtccggtttgctctttgaccctgagaaatcttcttcctcg
gacaaactgggaatcaccaaagtcatcgcccatgaactagcccatcaggttttaactcat
ctacaaactccgaagggtgcgtgtatcctgaacatgttgagggatttcctgacgccagag
gctttcaagtacggtattatacactacctgaagacacacagctaccagaacacagtgaac
gctcacctttgggaaagtctgaccaatatctgcacttctgatgaattggattcagggaga
ctaaaacttgatggattctgttccaaaaacagggctgaatctccagcctctcagaaatgg
ttcatggaggacagtgttgatgttcgagccattatggacacctggactctgcaggagggc
tttcctttaatcactgtggaggtcaaaggtcaagaggtcaccctcaaacaggagcgcttc
cttagagaagcaaactcctcaaagacttcaaagacatcaagcttcctgtggcaggttcct
ctgacttacatcaccagtcacagtagtgcaatgcagncgttcttgctgaaaagtgaaaaa
gatgtgttgtacctgccagagaaggtggactggattaaatttaacgtagacctgcgtggg
tattatattgtacattatgagtcaggaggctgggacgctttgatcaaccaactccagcag
aaccacagtgtgttcagcagcaacgacagagccagtctgatccacgacatctttcagctg
gtcagcattgagaaaatcccactggacaaagctctgaatctgagtttgtacctcagtaaa
gagtcggagatcatgccggtgacgcagggctttaatgagctggtgccgctctacaaactc
atggagaagagaaacatggaggaactggagaaccagctgaagggtcatttagtgaagtta
ttcaagacgctgattgaccgtcagagctggtctgacgacgggtctgtgtccgagcggatg
ctcaggaattatctgctgttgttcgcctgcgtccgtcgttacccatcatgcatcagcacc
gccactcaactcttccagcagtggaaggaatccgatggcaaaatgtggctgcccactgac
atcagtttagtggtctacactgaaggggcgcgtacagacgaaggctgggacttcctgttg
gagaaatacaagcgatccgtctcgccatcagagaagtggatgattaaagccgccctctcg
tacactccattaactcacaagcttcagtggcttttggaaagaagcatcgaaggagagatc
atgaaaactcaagacctgccgtcgctggtcatcactgtcagtaaaaacccaaaaggtttc
aaactcgcctgggacttcttgaaaaccaactgggggaaacttgtgaaaaagttcgatctc
ggttcgtctgcaatatctcgcatggcggtcggtgtgaccgatcagtattccaccagagaa
atgctccacgaggtactgtag

DBGET integrated database retrieval system