KEGG   Cyprinus carpio (common carp): 109059133Help
Entry
109059133         CDS       T05134                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4-like
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109059133
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccar01001]
    109059133
Enzymes [BR:ccar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109059133
Protein kinases [BR:ccar01001]
 Serine/threonine kinases: STE group
  STE20 family
   109059133
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase
Motif
Other DBs
NCBI-GeneID: 109059133
NCBI-ProteinID: XP_018931875
Position
Unknown
AA seq 393 aa AA seqDB search
MHPMRALFLIPRNPPPRLKSKKWSKKFFSFIETCLVKNYNHRPSTEQLLKHPFIRDQPNE
RHVRIQLKDHIDRTRKKRGERDETEYEYSGSEEEEEEPQEQEGEPSSIVNVPGESTLRRD
FIRLQQENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRR
EREMRRQQEREQRRKEQEDKRHKEEMELKRKEEEERRRVEEEKRRIDLEQEFIHRQLEEE
QRHLEIVQQQLLQEQAKLLADERYHKNLQGTPHAAPPKQPPLPQGSEPYTNENSPTETSG
MHRPMEPQVQWSHLAALKSNSSALHVSRSQSFSDPVPSFAQLHLRSQDSSHQHHPVHPSY
PDHPQPPQSRGLEAPEQTVDEEVPPRVRKGTMD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcatccgatgcgcgcccttttccttattcccagaaatcctcctccacggctcaagtca
aagaagtggtccaagaagttcttcagctttattgaaacctgcctagtgaagaattacaac
catcgcccctctacagagcaactgttgaaacatcctttcattagagaccaacctaatgag
aggcatgttcgcatccagctcaaagaccatatcgaccgcactcgtaagaagagaggagag
agagatgagacagaatatgagtacagtggaagtgaagaagaggaagaagagccacaagaa
caggaaggagaacccagttctatagtgaacgtgcctggtgaatctactctgcgacgtgac
ttcattcgtctgcagcaagagaataaggagcgatcagaggcactgaggagacaacagcta
ctccaggaacagcaactcagagaacaggaggagtataagcggcaattgttggctgagaga
cagaaacgcattgaacagcagaaggagcaaagacgacgacttgaggagcaacagcgacgg
gagcgtgagatgagacggcagcaagagcgggagcaaagacgcaaggagcaggaggacaaa
agacacaaggaggaaatggaacttaagcgtaaagaggaagaagagcgcaggagagtcgaa
gaggaaaagagaaggattgaccttgaacaggagtttatccaccggcagctcgaggaggag
caaagacatcttgaaatcgttcagcaacagctgctgcaggagcaggccaaactactggct
gatgagaggtatcataagaatcttcagggcacccctcatgctgctccacccaaacaacct
cctttgccacaaggatctgaaccgtacaccaatgaaaactcccccactgagacttcaggc
atgcacaggccaatggaaccacaggttcagtggtctcacttagctgctctaaagagcaac
tcatctgcactccatgtgtctcgctcccagtccttcagtgatcctgttcctagttttgca
caacttcatcttcgctctcaggactcctctcaccagcaccacccagtgcacccttcatac
cctgaccacccgcagcctcctcaatccaggggccttgaggcccctgagcagactgttgat
gaagaggtgcccccgagggtaagaaaagggaccatggattaa

DBGET integrated database retrieval system