KEGG   Cyprinus carpio (common carp): 109059483
Entry
109059483         CDS       T05134                                 

Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator-like protein 1
  KO
K02296  aryl hydrocarbon receptor nuclear translocator-like protein 1
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccar03000]
    109059483
Transcription factors [BR:ccar03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    109059483
SSDB
Motif
Pfam: PAS_11 HLH PAS_3 PAS PAS_9 PAS_4
Other DBs
NCBI-GeneID: 109059483
NCBI-ProteinID: XP_018932220
Position
Unknown
AA seq 568 aa
MADQRMDISSTMNEFMSQSSADLISSSIGTTGMDYNRKRKGSTTEYQIDGFSFDDSMDTD
KDKTMGRPAGSDKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMA
VQHMKTLRGAANPYTEANYKPAFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVYK
ILNYTQNDLIGSLMAFLLQRLVDKSFPLSTADRKSFCTIHSTGYLKSWPPTKMGLDEDNE
PDNEGCNLSCLVAIGRLHPHIIPLPMNGDIRVKPTEYVSRHAIDGKFVFVDQRATAILAY
LPQELLGTSFYEYFHQDDIGHLAECHRQVLQMREKINTNCYKFKIKDGSFITLRSRWFSF
MNPWTKEVEYIVSTNTVVSGSMLEGADPSYSQSASSPQSMDSVLTSGDGGGKRPLQTVPG
IPGGTRAGAGKIGRMIAEEVMEIQRIRGSSPSSCGSSPLNITATPPPDTCSPGGKKIQNG
GTPDLPSAGGTPDLPSAGILPGPDSIGYPYSNNSLMSDNSHLSIDIMEEPGSSSPSNDEA
AMAVIMSLLEADAGLGGPVDFSDLPWPL
NT seq 1707 nt   +upstreamnt  +downstreamnt
atggcagaccaaagaatggacatctcctccacgatgaatgagttcatgtcccagagttct
gcagatctcatcagcagttccattggcaccacgggcatggactacaaccgcaagaggaag
ggcagcaccaccgaataccagattgatggcttttcgtttgatgatagtatggacacagat
aaagataagacaatgggaagaccagcagggtcggataaaaatgccagggaggctcacagt
cagatagagaagagacgcagggataaaatgaacagttttatagacgagttggcttcgtta
gtccccacttgcaatgccatgtctcgcaagttagacaaactcactgtactgcgcatggct
gtccaacacatgaagacattacgaggggctgccaacccatacacagaagctaactataaa
ccagcattcttgtcggatgatgaattaaagcacttgattttaagggccgccgatggcttc
ctctttgtagttggttgcgatcgtggaaagattctgtttgtctcggagtctgtttataaa
attctcaattacactcagaatgatctgattggatctctaatggcttttttgcttcagagg
ctggtggataaatctttccctctctctacagcagaccgcaagagtttctgtaccatccat
agcactggctacctgaaaagctggccgcccaccaagatgggtttagatgaggataacgaa
cctgataatgagggctgtaacctcagctgtctagtggccatcggccgcctacacccacat
atcatccccctgcccatgaacggagacatccgcgttaaacccacagaatacgtctcccgc
cacgctatcgatggcaagtttgttttcgtcgaccagagggcgacagccatcctggcgtac
ttgcctcaggagcttctaggaacgtcattttatgagtattttcatcaggatgacatcggt
cacctcgccgagtgccacagacaagtgctacagatgagagaaaagattaatacgaactgt
tacaaattcaagataaaagacggctctttcatcactctgaggagccgctggttcagcttc
atgaacccctggactaaagaggtggaatatatcgtctctacaaacactgtggtttcgggc
agtatgctggaaggagcagatcctagttattcacagtcagcctcgtcccctcagagcatg
gacagcgttttaacatcaggagacggaggggggaaacgtcctcttcagacagttcctggt
attccaggagggactagagccggagctggcaagattggacgcatgatagctgaggaagtg
atggagattcagagaattcgaggctcctccccttcaagctgtggctccagtcctttaaat
atcactgccacgcccccacctgacacctgctctccagggggaaagaagattcaaaatggt
ggaactccagatctgccttcagcaggtggaactccagatctgccttcagcaggaattttg
cctggacccgattcgataggatacccatattcaaataactcattaatgagtgacaactcc
catctcagtattgacatcatggaagagcccgggtcaagcagccccagtaacgacgaggca
gccatggccgtcatcatgagcctcctagaagctgacgctggcctcggcggtcctgtggat
ttcagcgaccttccctggcctttgtga

DBGET integrated database retrieval system