KEGG   Cyprinus carpio (common carp): 109059956
Entry
109059956         CDS       T05134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: single-minded homolog 1-A-like
  KO
K09100  single-minded
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccar03000]
    109059956
Transcription factors [BR:ccar03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    109059956
SSDB
Motif
Pfam: SIM_C PAS_3 PAS_11 PAS HLH PAS_9 PAS_4
Other DBs
NCBI-GeneID: 109059956
NCBI-ProteinID: XP_018932664
Position
Unknown
AA seq 745 aa
MKEKSKNAARTRREKENSEFYELAKLLPLPSAITSQLDKASIIRLTTSYLKMRIVFPEGL
GESWGHVSRASSLDNVGRELGSHLLQTLDGFIFVVAPDGKIMYISETASVHLGLSQVELT
GNSIYEYIHPADHDEMTAVLTAHQPYHSHFVHEYEMERSFFLRMKCVLAKRNAGLTCGGY
KVIHCSGYLKIRQYSLDMSPFDGCYQNVGLVAVGHSLPPAAVTDIKLHSNMFMFRASLDM
KLIFLDSRVAELTGYEPQDLIEKTLYHHVHSCDTFHLRCAHHLLLVKGQVTTKYYRFLAK
QGGWVWVQSYATIVHNSRSSRPHCIVSVNYVLTDTEYKGLQLSLDQATSTKPSFTYNSPP
TPIIENRRVGKSRVSRTKTKTRLSPYSQYPGFPRYRSESDQDSESESGXPMGGSPLTDSA
SPQLLEQCEGIDSSCVYRQFPEPRPLCYSLPLTDDHHTSSDLYGHTHSESCERGRCKAGR
YFLGTPQPGREAWWGAARSVLPLPKSSSENGDSFEGVMPHITSIHSLQVRGHWDEDSMVS
SPDTSDSGDRYHGEQCRSSPQEPSKIETLIRATQQMIKEEESRLQLRKASTEIPLESTNS
LAKSHGSSFHSTDFSQSALQSVVCRGPAQVISPTTSPVPLSRLSSPISDRLGKSKDFLQN
ELSSSQQHQQPLPLTGTCAVSPTPALFMASNSIQVVHRVGWRARPVKGNRILTVENLVRG
AVADCGSVEDLGQGAELAEQEAKVE
NT seq 2238 nt   +upstreamnt  +downstreamnt
atgaaggagaagtcgaagaacgcggcgcggacgcggcgcgagaaggagaacagcgagttc
tatgagctggccaaactgctgcctctgccctcggccatcacctcacagctggacaaagcc
tccatcatcagactgaccaccagctacctgaagatgaggatagtcttcccagaaggtctc
ggggaatcttggggtcatgtgagtcgagcgagttctctggacaatgtgggccgagagtta
ggatcacatctgcttcagactttggatggcttcatttttgtggtagctcctgatgggaaa
atcatgtacatttctgaaactgcatcagtgcatttagggctgtcacaggtagagctgacg
gggaacagcatttatgaatacatccaccccgcagaccacgacgagatgaccgcagtcctg
acggctcaccagccgtatcattcacacttcgtccacgaatatgaaatggaaaggtctttt
ttcctgagaatgaaatgtgtccttgctaaaagaaatgctggcttgacgtgtggtggttac
aaggtcattcactgcagcggctatctgaagatccgtcagtacagcttagacatgtctccg
tttgacggctgttatcagaacgtgggtctggttgctgtgggtcactctctccccccagcc
gcagtaaccgacatcaagctccacagcaatatgttcatgttcagagccagcctggacatg
aaactcattttcctggactccagggttgcggagctcactggctacgagccgcaagactta
atagagaagacactttatcatcacgtccacagctgtgacactttccatctccgctgcgcg
caccacttgttgctagtaaagggacaagtcaccaccaaatactaccgattcctggctaag
cagggtgggtgggtgtgggtacagagttacgctactatcgtacacaacagcagatcgtcc
agaccacactgcatcgtcagcgtcaactacgtcctcacggacacagagtacaaaggacta
cagttgtccttagatcaggcgacatccactaaaccctcgttcacctacaacagcccccct
acccccatcattgagaacagaagagttggcaaaagcagagtctcccgtaccaagaccaaa
acaagactctcgccctattcacagtatccgggtttccccaggtatcgctcagagtcagat
caggatagtgagtcagagtcaggatagcccatgggaggaagcccactcactgactctgca
tctcctcagcttctggagcagtgtgaaggcatagactcctcatgcgtgtaccggcagttc
ccagaaccacggccgctgtgctacagcctaccactgacagatgaccatcatacctctagt
gatctctacggccacactcactccgagtcctgcgagaggggtcgctgtaaggctggccga
tacttccttggcacccctcagcctggacgagaggcatggtggggtgcagctcgctctgtt
ctcccattgcccaagtcttcatccgagaatggggacagttttgaaggtgtgatgccccac
atcacctctatccatagcctgcaagtgaggggtcactgggatgaggacagcatggtcagt
tcacctgacacgagcgattcaggtgaccgataccatggtgagcaatgccgttcaagtcct
caagagcccagcaagattgagacgttgattcgagccacgcaacagatgatcaaagaggag
gaaagtcgtctccagttgagaaaggcttctacagaaatacctttggagtctacaaacagt
ctggcaaagagccacggctcctcgtttcacagtaccgacttttcccagtcagcattgcag
agtgtggtgtgtcgagggccggctcaggttataagccccaccactagtcctgttcctctg
tcccgtctcagcagccccatctctgacagactgggtaaaagtaaagacttcctgcaaaat
gagctctcctcttctcagcaacaccagcagccactgcccctgacgggcacatgtgctgtc
tctccgactccagcgctattcatggcttcaaattccatccaggtggtccatagagtagga
tggagggccaggcctgtgaaggggaacaggatcctgacagtggagaacctggtccgtgga
gcagtggcagactgtggatcagtggaggacctgggccaaggagcagagctggcggagcag
gaagccaaggtggagtag

DBGET integrated database retrieval system