KEGG   Cyprinus carpio (common carp): 109061883
Entry
109061883         CDS       T05134                                 

Definition
(RefSeq) circadian locomoter output cycles protein kaput-like
  KO
K09026  neuronal PAS domain-containing protein 2
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccar03000]
    109061883
Transcription factors [BR:ccar03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    109061883
SSDB
Motif
Pfam: PAS_11 PAS_3
Other DBs
NCBI-GeneID: 109061883
NCBI-ProteinID: XP_018934509
Position
Unknown
AA seq 665 aa
MSSLSFPCALFFFSFILSDETHIEFCCHLARGNIDPKEPPTYEYVKFVGDFKFHNNVPLS
SCNGYDLAFPRTLQSTLEEQICLVATVRLVTPQFLKDLCNVEDVCDEFTSRHSLEWKFLF
LDHRASPIIGYLPFEVLGTSGYDYYHVDDLELIAQCHKQLMQFGKGKSCYYRFLTKGQQW
IWLQTHYYITYHQWNSKPEFIVCTHSVVSYAEVRAERRREIGLEESSSDMATSSVKGQEV
FLDMCPPLEAPRERISSARSVSSQSSRKSSHTALSDSASNSSVRYTEACTSSRQSASIGP
EKSSSRMPHSGSKTLIQRQSSSEPTSLSPSCSQHSTVTQSLYRFQQPQLGVMHQLKEQLE
ERTRILQADIKTQQQELHDIKEKLQLANLQMLLQQPIQGEFASTGLQQQGPGRPSQHSTQ
PKPQHCVSHSSHTLLREQPSSSSAQGQQRLVQTGHMQTVSVPMQTHTSLTTPFYSNPMMF
SPNHGHRTQQDTHCQRLAHTDYSQDGQLRMLLNQSMQTLVPDSSGGTQSSQCSSAIQQTK
YPLDQQMMAPSFPVQQVNCNAVLVPSPVFTSPIMIPHNSFITHQATPTYTPHLSAAPHSL
PLQQPQQFFQMQPQGLIQSAPTQALFHTPSVPQQSTVGYVQPQQQQQHHHSQSGNLSDYR
NMLPR
NT seq 1998 nt   +upstreamnt  +downstreamnt
atgtcgtctctttcctttccctgtgcactctttttcttttctttcattctttcagatgag
acacacatcgagttctgctgtcatttagcaaggggaaacattgacccaaaagaaccgccc
acgtacgaatatgtcaaatttgttggagatttcaagtttcataataacgtgcctctgtcc
tcatgtaacggttatgatctggcgttcccacgcacgctgcagtccacattagaggagcag
atctgtctcgtagccacagtgagactcgtgacccctcagttcctaaaggatctgtgcaac
gtggaggatgtgtgtgatgaattcacatcaaggcacagcctggaatggaaatttctcttc
ttagatcatagggcctctcctatcattgggtacctgccgtttgaggttttagggacttcg
ggttatgattactaccatgtggacgacctggagctgattgctcagtgtcataaacaattg
atgcagtttgggaaaggaaaatcctgttactatcggtttctgactaaagggcagcagtgg
atctggctacagacacactattacatcacataccaccagtggaactccaaaccagagttt
atcgtctgtacacacagtgtggtcagctatgctgaagtccgagcagaaagaaggagagag
attggattggaggaaagctcatctgatatggcaacatcctcagtcaaggggcaggaggtg
tttttggacatgtgtcctcctttagaagctccacgggaaagaatcagcagcgctcgatca
gtgtcatcacaaagttctagaaaatcatcacacacagcgctgtctgactctgcgtcgaac
tcatcggtgaggtacacagaggcatgtacgtcgtcacggcagtctgcttccattggtcct
gagaagagttccagcagaatgccacatagtggatcaaagaccctgattcagaggcagagc
tcctctgagcccacgtcactctccccctcctgcagtcagcattccactgtgacacaatct
ctgtacagattccagcagcctcagttaggcgtcatgcatcagctgaaagagcagctagaa
gagcggacacgcatcctacaggccgacatcaaaacacaacaacaagagctgcacgacatt
aaagagaaactacagcttgctaatctacagatgttactccagcagccgatacagggagaa
tttgccagtactggtctgcagcagcagggtccaggcaggccgtcccaacacagcacccag
cccaaacctcaacactgtgtttcacattcatcacacacactactcagagaacagcccagt
agctcatctgctcagggccagcagagactggttcagactggacacatgcagaccgtcagt
gttccaatgcagacacacaccagtctcaccacacccttctatagcaacccaatgatgttc
tcacccaaccacggacaccgaacccaacaggacacacactgccaaagactcgcacacaca
gactacagccaggacggacagctacggatgctactaaaccaatcaatgcagacgcttgta
ccagacagcagtggggggacccagtcttcccaatgcagctcagctattcaacaaaccaaa
tatcctctggaccagcagatgatggctccttccttccctgtacagcaggtgaactgtaac
gctgtgcttgtcccttcccccgtcttcacctcaccaatcatgatcccccataatagtttc
atcacccatcaggccacgcccacctacacgcctcacctgtcggctgccccacacagctta
ccactacaacaacctcagcagttctttcagatgcagcctcagggtctgattcagagtgct
cccactcaggccttattccacacccctagcgttccacagcaaagcactgtgggatatgta
cagccacaacaacagcagcagcatcatcactcacagtccggcaacctgtcggactacaga
aacatgctcccacggtag

DBGET integrated database retrieval system