KEGG   Cyprinus carpio (common carp): 109062786
Entry
109062786         CDS       T05134                                 

Definition
(RefSeq) aryl hydrocarbon receptor repressor-like isoform X1
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccar03000]
    109062786
Transcription factors [BR:ccar03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    109062786
SSDB
Motif
Pfam: PAS HLH PAS_4 PAS_9 PAS_3
Other DBs
NCBI-GeneID: 109062786
NCBI-ProteinID: XP_018935402
Position
Unknown
AA seq 313 aa
MIPPGDCLYAGRKRRKPVQKQKPEKAGQKSNPSKRHRDRLNAELDRLASLLPFSADVISK
LDKLSVLRLSVSFLRVKSFFQEIENCSTDASTSEQKKEILPRVIESDLLLKSLPGFALIV
SSDGVIFYASCTIADYLGFHQTDVMHQKVFDYIHVDERQEFHRQLHWAMNPGQQDTVDED
AVMGHLYSAEEPDGVSPKLSPFLTRCFITRVRCLLDSSSGFLNMQFQGSLKFLQGQKRKT
DSGALLPPQFALFCVAVPLVLPSIVELKMKSMMMKSKHNRSGSRYTFCLSIHIRAAQLIK
FLIVIKIMDATIT
NT seq 942 nt   +upstreamnt  +downstreamnt
atgattccgcctggagactgtctgtacgccggaaggaaaagaagaaaacctgtgcagaaa
cagaaaccagagaaagcaggtcagaaatcgaatccgtccaagcgtcaccgcgaccgtctg
aatgcagaattggaccggttagcgagtctgctgcccttcagtgcagatgtcatctccaaa
ctggacaaactctcagtgctgcggctcagcgtcagcttcctgcgggtgaagagcttcttt
caagagatagaaaattgcagcactgatgcctcaacgtcggagcagaagaaagagatcctg
ccccgtgtcatagagagtgatcttctcctaaagtctctccctggatttgcactgatcgtg
agctcggatggcgttattttctatgcatcatgcactatcgctgactacctgggatttcat
cagacggacgtgatgcatcagaaggtctttgactatatccatgtggatgagcgacaggag
tttcacaggcagctccactgggcgatgaaccctggccagcaagacactgttgatgaggat
gctgtgatgggtcatctgtatagcgctgaagagcctgacggcgtttctcctaaattgtct
ccgtttctcacgcggtgcttcatcactcgagtccgctgcctgctggacagcagctccggc
ttcctgaacatgcaatttcagggcagcctgaagttcctgcagggtcagaagaggaagacg
gactctggagctctgctgccgcctcagtttgctctgttctgtgtggctgttcctctagtc
ttgccctccatcgtggagctcaagatgaagagtatgatgatgaagagcaaacacaatagg
tctggcagcaggtacacattctgcctgtctatccatattagggctgcacagttaatcaaa
tttctaatcgtaattaaaattatggatgccacaattacataa

DBGET integrated database retrieval system