KEGG   Cyprinus carpio (common carp): 109062934
Entry
109062934         CDS       T05134                                 

Definition
(RefSeq) retinol dehydrogenase 7-like isoform X1
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    109062934
Enzymes [BR:ccar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     109062934
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 RELT
Other DBs
NCBI-GeneID: 109062934
NCBI-ProteinID: XP_018935547
Position
6
AA seq 443 aa
MLLSLLKCPVNLPKTDSINLKIKRIGMFLLKSSSQPSYLWITLTQASQKKGLTAIQCDWR
LEIVALSDRISFRDKDADPLQITHQTRSGPPAPEPRREKQLFTKHLRRITQEAETMYEYL
SNNCTCTYVLGAFVLLWVLVWFYRDNLEITKVSEKHVFVTGCDSGFGHLLCKLLDKRGFR
VLAGCFTEKGADDLKSATGPFLKTCILDVTSTTSIQKALEWTKKEVGDKGLWGLVNNAGR
SLPMGPSEWMKIEDFQSTLKVNMTGMIEMTMDFLPLVKKARGRVVNVASVLGRVAANGGG
YCISKFAVESFSDCLRRDIQNFGVNVCIIEPGFFKTQVTSLEPIERELHRLWNQLTPEVQ
ESYGDKYLDKYIKIQRLIMNTICDSDLSKVTNCMEHALLAVHPRTRYSAGWDAKLLWIPL
SYMPACVVDIALKLVLPKPAKSV
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgctcctgtcattgcttaagtgtcctgtcaacctcccaaaaactgattcgatcaaccta
aaaataaagcgtattggcatgtttctccttaaaagttcctcccagcccagctatttgtgg
atcacgcttacacaagcctcacaaaaaaaaggcctaacagcaatacagtgtgattggaga
ttagaaattgtggctctgtctgatagaatcagctttagggataaagacgcagacccactt
cagatcactcaccaaacgcgttcaggacctccagctccagagccaagaagggaaaagcaa
ttgtttacaaaacatcttcgcagaatcactcaggaggcagaaacgatgtacgagtacttg
agtaacaattgtacatgcacatatgtcttgggtgcgtttgtgctgctatgggtgctggtg
tggttctaccgggacaacttggagatcaccaaggtctcggagaaacacgtttttgtgacc
ggttgcgactctgggttcggacatctactgtgcaagctcctggacaaacgtggtttccgt
gtcctagccgggtgtttcacggaaaagggcgcagatgatctgaagagtgcgacaggaccc
ttccttaagacctgcatcttggacgtgaccagcacgaccagcattcagaaggctttggaa
tggaccaaaaaagaagttggagataaaggactttggggtctcgtgaacaatgcaggacgc
tcccttcccatgggtccatcagaatggatgaaaatcgaagacttccaaagcacacttaaa
gtcaacatgactggcatgattgagatgacgatggacttcttgcctcttgtcaaaaaggcc
cgtggacgagtggtgaatgtggcgtcagtgttgggaagagtggcagctaacggcggagga
tattgcatttcaaagttcgcagtggagagcttctctgattgtctcaggagggacatccag
aattttggggtcaatgtgtgcatcattgaacctggtttcttcaagactcaggtgaccagc
ttggagcccatcgagagggaacttcatcgcctctggaaccaattgacccctgaagtgcag
gagagttatggagacaaatacttggataaatacatcaagatccagaggctgatcatgaac
accatatgcgactctgacctcagtaaagtgaccaactgcatggaacacgccctgctggcc
gtccacccaagaacacgctacagcgcaggctgggacgccaagctcttgtggattcccttg
tcttatatgcctgcttgtgttgtagatatcgcgctgaagctggtgttgccaaagcctgca
aaaagtgtatga

DBGET integrated database retrieval system