KEGG   Cyprinus carpio (common carp): 109063736
Entry
109063736         CDS       T05134                                 

Definition
(RefSeq) uncharacterized protein LOC109063736
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccar03000]
    109063736
Transcription factors [BR:ccar03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    109063736
SSDB
Motif
Pfam: PAS
Other DBs
NCBI-GeneID: 109063736
NCBI-ProteinID: XP_018936310
Position
Unknown
AA seq 451 aa
MVAVTGKDDVEGMKMVVEGYGKLSSAKTDVMHQNVFDYIHVDDRQEFRRQLHWAMNPSAQ
SGSGEDFVFSSLFHSDVPPEFSCFLNRCFILRIRCLLDSTSGFLTDVMHQNVFDYIHVDD
RQEFRRLGCTGPVNPWHKAARVRLHLHTTHTHTPHEPFGTKRLGCDYIYIQHTHTLQTHT
LCNADVCFVGEDFVFSSLFHSDVPPEFSCFLNRCFILRIRCLLDSTSGFLTMQFQGRLKF
LHGQRKKTSSGALLPPQLALFCVAVPLLLPSIAEMKMKSGVMKGKHRNPGLLTSLDQNDR
DDALRHASLLSKDSVKYKTEGPYGPDEPLNFCKMSGQKFTNLDCSAWPSRSSSVLGKHYA
KPYRSAPGCYSSRAEAFVPKPYESDCGADGVKSEGFCFDGYDTQAVLEPAVKVEQDSDSE
NGSWTQMKAEAGFGEQYSCQRLKGAPYAGHY
NT seq 1356 nt   +upstreamnt  +downstreamnt
atggtggctgttactggaaaagatgatgtagaaggaatgaaaatggttgtggaggggtat
ggaaaattatcatcagcaaaaacggatgtgatgcatcagaacgtgttcgactacattcat
gtggacgaccggcaggagttcagacggcagctgcactgggccatgaacccttcggcacaa
agcggctcgggtgaagatttcgtgttcagcagtttgtttcactctgacgttcctccagag
ttctcctgcttcttaaaccgctgctttatcctgcggatccgctgcttactggacagcacc
tccggattcctgacggatgtgatgcatcagaacgtgttcgactacattcatgtggacgac
cggcaggagttcagacggctaggctgcactgggccagtgaacccttggcacaaagcggct
cgggtgcgactacatctacatacaacacacacacacactccccatgaacccttcggcaca
aagcggctcgggtgcgactacatctacatacaacacacacacacactccagactcacacg
ctgtgtaatgctgatgtctgttttgtaggtgaagatttcgtgttcagcagtttgtttcac
tctgacgttcctccagagttctcctgcttcttaaaccgctgctttatcctgcggatccgc
tgcttactggacagcacctccggattcctgacgatgcagtttcagggaagactgaagttc
cttcacggtcagaggaagaagacgtcgtccggagcacttcttcctcctcagctggcgctg
ttctgtgttgctgtgcctctgctcctgccctccatcgccgagatgaagatgaagagtggc
gtgatgaagggcaaacacaggaaccccgggcttctcacctcgttagatcaaaatgacaga
gacgatgcactcagacatgcctcgctcctgagcaaagacagcgtcaagtacaagaccgaa
gggccctatggccccgacgagcctctcaacttctgcaagatgagtggtcagaagttcaca
aacctggactgcagcgcctggccctcaagaagctcctcggtcctcggcaaacactatgct
aaaccgtatcgatcggccccgggatgttacagctccagagccgaggccttcgtccccaag
ccctacgagagcgactgcggcgcagatggtgtcaagagtgagggcttctgcttcgacgga
tatgacactcaggcggtgctggagccggcggtgaaggtggagcaggactcggactcggag
aacggttcgtggacacagatgaaagcggaggctggattcggagagcagtactcctgtcag
cggctgaagggagcgccgtacgccggacattattag

DBGET integrated database retrieval system