KEGG   Cyprinus carpio (common carp): 109064799
Entry
109064799         CDS       T05134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: endoplasmic reticulum aminopeptidase 2-like
  KO
K13723  endoplasmic reticulum aminopeptidase 2 [EC:3.4.11.-]
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ccar01002]
    109064799
Enzymes [BR:ccar01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     109064799
Peptidases and inhibitors [BR:ccar01002]
 Metallo peptidases
  Family M1
   109064799
SSDB
Motif
Pfam: ERAP1_C Peptidase_M1_N Peptidase_M1
Other DBs
NCBI-GeneID: 109064799
NCBI-ProteinID: XP_018937374
Position
Unknown
AA seq 773 aa
MHLLLVILFFLEAQFCVQSSDSSSPAGENLATNGLPFPWSKVRLPSYIVPVHYHLLIHPN
LTTLRFNGSVKIEIDVKNNTNWVVLHSKNLKIFTATVLDEHEAHLSDKVLSVLEYPSHEQ
IAIFSPKILTSGEKYFLYLEFGAPLSDGFYGFYKSTYKTKAGETRVLASTHFEPTSARMA
LPCFDEPIFKANYTVRIRRGPSHIALSNMPLEQTVEIGNGLFEDQFEVSVRMSSYLLARD
SLNSSRPISSLAENPAQIEEMFDTVSYDKGACILHMLRNFLTNEGFQSGIIRYLRRFKYS
NARNEDLWDSLIKTCSEEEFTAGEYCYSSTQATKNAYRFAGEHIDLKKMMYTWTLQKGIP
LITVKRQGRKLYIGQERFLKIVLPDDPSWHSLQEGYLWHIPLTYKTSHSDYEMKHILTTK
SDVLTLDEEVDWVKLNSDMNGYYIVHYDEEGWNALTELLRINHTALSFKDRASLIHNAFQ
LVTAGRLSLNRALDLIGYLKSETHNVPLLQGLGYLQSFYKMIEKRNIADITHNLKTYILQ
YFRDVIDKQSWSDDGMVSDRRLREEVLSLACDFDYPPCLEKAKHLYNSWVESNGAISLPT
DVSETVYMVGAQDDSGWAYLLEKYGVSMCETEKSKFLSALASSKDSEKLSRLLQLGINGT
LIKTQNLPSLIYLVAKNPVGHFLAWDFVKKHWDELVEKFPLGSFGIRNIIVGTVTQFSST
EELREVEDFFKSITEQVSELRVIQVATENVEKNIMWLSRNLETMRTWLQQRLN
NT seq 2322 nt   +upstreamnt  +downstreamnt
atgcatctcttgcttgtaatcctgttctttctggaggcacagttttgtgtccagtcatct
gacagcagtagtcctgctggtgaaaacctggcgacaaacggccttccttttccatggagt
aaagtgcgcctgccaagctacatagtgcctgtacattatcatctacttattcatcccaat
ctcaccaccctgaggttcaatggatctgtgaagattgaaatcgatgttaaaaacaataca
aactgggtggtgctacacagcaagaacctcaagatcttcacagccactgttctggatgag
cacgaggcccatctgtcagacaaagtgctctcggtgctggaatatccttcacacgaacag
atcgccatcttctccccaaagattctgacctctggggaaaaatacttcctgtatttggaa
tttggtgcaccattaagtgatggcttctatggattttataagagtacatataagacaaag
gcaggagagacaagggtcctggcatccacccattttgagcccacatctgcccgaatggca
ttgccatgcttcgatgagcccattttcaaagctaattacacagtcagaataaggaggggc
ccgtcacatatagctttgtccaacatgccattagaacaaactgtggaaattggcaacggt
ctgtttgaggaccagtttgaagtgagtgtgaggatgagctcgtacctgctggcacgggat
tctctaaattcttccaggccaatttccagtttagctgagaaccctgctcagatagaggaa
atgtttgatactgtgtcatatgacaagggagcatgtattctccatatgctgaggaatttc
ttgacaaatgaaggctttcagagtggcataattcggtaccttcgtaggttcaagtacagc
aatgccagaaatgaagacctgtgggacagccttattaaaacatgttcagaagaggaattt
acagcaggagaatactgttacagcagtacacaagccactaaaaatgcgtatcgttttgct
ggggagcatatagacctgaaaaaaatgatgtatacatggactctacaaaagggcataccg
ctgatcacagtgaagcggcaaggaaggaaactgtatattgggcaagagcgcttcttaaag
atagtcctgcctgatgatccctcatggcattcacttcaagaaggctacctgtggcacatc
cctttgacatataaaacaagccactctgactatgagatgaagcacatcttgaccacaaaa
tcagatgtgttgacgctggatgaggaagttgactgggtgaagctcaacagtgacatgaat
ggatattatattgtccattatgatgaggaaggctggaacgccctgacggagctgctgaga
ataaaccatactgctctgagctttaaggacagagccagcctcattcataacgccttccag
ctggtcactgcaggacgactgtcactaaacagagctttagatttgatcgggtacttgaag
tctgagacccacaatgttcctctcctgcaagggcttggctatctacaatcattctacaag
atgatagagaagagaaacatagctgacattactcataatctgaagacctacatcttgcag
tatttcagagatgtgattgacaaacagtcatggagtgatgatgggatggtctcagaccgg
agactgcgtgaagaggttctttcccttgcatgtgattttgattatccaccttgtttggaa
aaggctaagcacctctataatagctgggtggaatccaatggtgcaatcagcttacccact
gatgtgtctgagacggtttacatggttggagctcaggatgacagcggttgggcctacctt
ctggaaaagtatggtgtctccatgtgtgagacagagaaaagcaaatttctctcagcttta
gcaagcagcaaggactctgaaaaactatcaagattattacagcttggaataaatggaact
ctaataaaaacacaaaatttacccagtctcatatatttggtggccaaaaatccagtgggt
catttcctagcatgggattttgtgaagaaacattgggatgaattagtagaaaagtttccg
ctgggatcttttggaatcagaaatataattgttggcactgtgactcagttctcatcgaca
gaggagttgagagaggttgaggatttcttcaagtccatcacagagcaggtatctgagctg
cgtgtcatacaggtggccacagaaaatgtggagaagaatattatgtggctctccaggaat
ctagagaccatgaggacttggttgcagcaaagactcaattaa

DBGET integrated database retrieval system