KEGG   Cyprinus carpio (common carp): 109064890Help
Entry
109064890         CDS       T05134                                 

Definition
(RefSeq) serine--pyruvate aminotransferase, mitochondrial-like
  KO
K00830  alanine-glyoxylate transaminase / serine-glyoxylate transaminase / serine-pyruvate transaminase [EC:2.6.1.44 2.6.1.45 2.6.1.51]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00250  Alanine, aspartate and glutamate metabolism
ccar00260  Glycine, serine and threonine metabolism
ccar00630  Glyoxylate and dicarboxylate metabolism
ccar01100  Metabolic pathways
ccar01200  Carbon metabolism
ccar04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    109064890
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109064890
   00260 Glycine, serine and threonine metabolism
    109064890
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109064890
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ccar01007]
    109064890
Enzymes [BR:ccar01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.44  alanine---glyoxylate transaminase
     109064890
    2.6.1.45  serine---glyoxylate transaminase
     109064890
    2.6.1.51  serine---pyruvate transaminase
     109064890
Amino acid related enzymes [BR:ccar01007]
 Aminotransferase (transaminase)
  Class V
   109064890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-GeneID: 109064890
NCBI-ProteinID: XP_018937465
Position
Unknown
AA seq 237 aa AA seqDB search
MSVLSTVLPRSLAWFCLYRYNCLLLVDSVASLGAAPLLMDQQNIDILYTGSQKALNAPPG
TAPISFSERACHKMFNRKTKPVSYLLDMTHLSNYWGNDGKPERKYHHTGPVSGFFALRES
LAILAEMGLENSWSHHTEVAEYLWKGLEDLGLKLFIKDKDLRLPSVTTIAIPEGYDWKEL
LAYIMKHHQIEFTGGLGPSVGMVLRIGLMGYNCNKANAAMALAALEDALKQCRKSKA
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtattgtctactgttcttccacgttctcttgcatggttttgtctatacagatac
aactgtttgctcttagtggattcagtggcatcattgggagctgcaccgcttttaatggac
caacaaaatattgatattctgtatactggttcccaaaaagctttaaatgctccacccggc
acagcaccaatttcattcagtgaaagagcatgccacaagatgtttaacaggaaaacaaag
ccagtgtcctacctccttgatatgacccacttatccaattactggggcaatgacggcaag
ccagaaagaaagtaccatcacacaggacctgtgtctgggttctttgccttgagggaaagt
ctagccatccttgctgaaatgggtcttgagaactcatggagtcatcatacagaagttgca
gagtatctctggaagggcttggaagacctgggcttgaagctgtttatcaaggacaaggat
ctgagattaccctccgtcaccaccattgcaatccctgaagggtatgactggaaagaattg
ctggcttacatcatgaagcatcaccaaatcgagtttacaggaggtctagggccctctgtt
ggcatggtattgaggatcgggctcatgggatacaactgcaacaaggccaatgctgcgatg
gctcttgcagctctggaagacgctttaaagcagtgtcgaaaatccaaagcctaa

DBGET integrated database retrieval system