KEGG   Cyprinus carpio (common carp): 109065990Help
Entry
109065990         CDS       T05134                                 

Definition
(RefSeq) sodium/potassium-transporting ATPase subunit alpha-3-like
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04260  Cardiac muscle contraction
ccar04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    109065990
   04261 Adrenergic signaling in cardiomyocytes
    109065990
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccar04147]
    109065990
Enzymes [BR:ccar01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     109065990
Exosome [BR:ccar04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109065990
  Exosomal proteins of other body fluids (saliva and urine)
   109065990
  Exosomal proteins of colorectal cancer cells
   109065990
  Exosomal proteins of bladder cancer cells
   109065990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cation_ATPase_N
Motif
Other DBs
NCBI-GeneID: 109065990
NCBI-ProteinID: XP_018938519
Position
Unknown
AA seq 164 aa AA seqDB search
MRSSVSWLSSRSDSVADLRIILHFFFQYGRSDSYRVATTQDTNEKESPKKGKGGKDLDDL
KKEVPLTEHKMSIEEVCRKFNTDIVQGLTNAKAAEYLARDGPNALTPPPTTPEWVKFCRQ
LFGGFSILLWIGAILCFLAYAIQAATEDEPANDNLYLGIVLSAR
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgcgttccagtgttagctggctttcttctcggtctgattccgtagctgatctaagaata
atcctacattttttcttccagtatggacggtcggacagctaccgcgtggcaaccacgcag
gacacaaatgagaaggagtctcccaaaaagggaaagggaggaaaagatctggatgacctg
aagaaggaagtaccactgacagagcataagatgtcaattgaagaagtatgccgaaaattc
aacactgacattgtacagggtctgactaatgccaaggcggcggagtacctcgctcgggat
ggtcccaatgctctcaccccaccccctaccaccccagagtgggtcaaattctgccgacag
ctcttcggaggattctccatcctgctgtggatcggagccatcctctgcttcctggcctac
gccatccaggccgccacggaggacgagcctgccaatgacaatttgtatctggggatcgtg
ctgtctgctagataa

DBGET integrated database retrieval system