KEGG   Cyprinus carpio (common carp): 109066967
Entry
109066967         CDS       T05134                                 

Definition
(RefSeq) circadian locomoter output cycles protein kaput-like
  KO
K02223  circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccar03000]
    109066967
   03036 Chromosome and associated proteins [BR:ccar03036]
    109066967
Enzymes [BR:ccar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     109066967
Transcription factors [BR:ccar03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    109066967
Chromosome and associated proteins [BR:ccar03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    109066967
SSDB
Motif
Pfam: PAS_11 PAS_3 HLH PAS PAS_9 EMC3_TMCO1 OmpH ThiD2 UPF0565
Other DBs
NCBI-GeneID: 109066967
NCBI-ProteinID: XP_018939526
Position
Unknown
AA seq 815 aa
MTSSIDRDDSSIFDGLMEEDEKDKAKRVSRNKSEKKRRDQFNVLIKELGTMLPGNTRKMD
KSTILQKSIDFLRKHKEIAAQSESSEIRQDWKPPFLSNEEFTQLMLEALDGFFLAIMTDG
NIIYVSESVTSLLEHLPSDLVDQNLLNFLPLGEHSEVYKALSTHKLEGETLTPDYLKTKN
QLEFCCHMLRGTIDPKEPPVYEYVKFIGNFKSLNTVPNSTRNGFEGVIQRSLRPMFEDRV
CFIATVRLAKPQFIKEMCFVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSG
YDYYHVDDLETLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYHQWNSRPEFI
VCTHTVVSYAEVRAEQRRELGIEESPPEISADKSQDSGSESQLNTSSLKEALERFDHSRT
PSASSRSSRKSSSHTAVSDPTSTQTKLQTDHSTPPRQSVSAIEMTSQRRSSISSQSMSSQ
NTGQTMATSLVSQPQQPQPLQPSVQPVLQFSTQMDAMQHLKEQLEQRTRMIEANIQRQQE
ELRQIQEELQRVQGQNLQMFLQPGGSSLNLGSVQLTQGSSVQSGGSLSMQGAVVPTGSLQ
STHTGTQHTVTQHPQQAPPQQQNLLRDQSSNLTQSQRTSHTLQPPQGALPASLYNTMMIS
QPAQANVVQISTSLAQNSSPSGAAVATFSQDRQIRFPAAPQLLTKLVTGPMACGAVMVPT
TMFMGQVVTAFAPQQGQGQTISITQQPSAQMQEQQAQTQSQTATGTAQQQGQAQAQLAQQ
QTQFLQTSFFLVGVESTCVWLMKLIWSVHVNVEEK
NT seq 2448 nt   +upstreamnt  +downstreamnt
atgacctccagcatagaccgggatgacagcagcatctttgatgggttgatggaagaagat
gagaaggacaaagcaaaaagagtttctaggaacaagtcggagaagaagaggcgagaccag
ttcaatgtgctcatcaaggaactgggcaccatgttgccgggcaacacccgcaagatggac
aagtctacgatcctacaaaagagcatcgacttcctgcgcaagcacaaagaaattgccgca
cagtctgagtcgagtgaaatccgtcaggactggaagccgccctttcttagcaatgaggag
ttcacacagctgatgctggaggcactagatggcttctttttggccatcatgacggacgga
aacataatctacgtctcagaaagtgtcacgtctttattagaacatctaccttctgatctt
gtagatcagaatctgttgaatttccttccactgggtgagcactcagaggtgtataaagcc
ctgtccacacacaagctggagggagagaccctcaccccagactacctaaaaacaaagaac
cagttagagttctgttgccacatgctccggggcacgatcgacccgaaagagccgcccgtt
tatgagtatgttaagttcatcggaaactttaagtcccttaacactgtgcctaactcaaca
cgtaacggctttgagggagtgatccagcgatcgctgaggcccatgtttgaagaccgagtg
tgtttcatagcaactgtgaggttagccaagcctcagtttatcaaggaaatgtgttttgtg
gaggagcccaatgaggaattcacctccagacatagtttagagtggaaattcctcttcttg
gaccacagggcacctcccatcataggctacctaccctttgaggttctgggtacttcaggg
tatgactattatcatgtggatgacctggagaccctggccaagtgccatgaacacttgatg
cagtacggtaaggggaagtcatgctattaccgtttcctgactaaaggtcagcagtggatc
tggcttcagactcactactatatcacctaccaccagtggaactcacggccggagttcatc
gtctgcacgcacactgtggtcagttatgctgaagtgagggctgaacagcgcagggagctg
ggcattgaggaatcacctcctgagatctcagcagacaagtcccaggactccggctcggag
tcccagttgaacacctccagcctgaaggaggcgctagagcgattcgatcacagccgcaca
ccctccgcttcatcacggagctcccgaaagtcctcctcacacaccgccgtctcggaccct
acgtccacacagacaaagctgcagacagaccatagcacacccccccgccaatcagtgtca
gccattgagatgacatcacagcggaggtcctctattagcagtcagtcaatgagttctcag
aacacaggacagacgatggcaacatctcttgtgtctcagcctcagcagcctcaaccactt
cagcccagtgtgcagccggtgctgcagttttccacgcagatggatgcaatgcagcatctt
aaggagcagctggaacagcgcacacgcatgattgaggccaacatccagagacaacaagag
gaactgcggcaaatccaggaggagctgcagagggtgcaaggacagaacttacagatgttc
ttgcagcccggaggcagcagtctcaacctcggctcagtgcagctgacgcagggatcatcc
gtgcagtcagggggctctctgtccatgcagggggcggtggtgccgacaggaagcctgcaa
tccacacatacagggacacaacacactgttacacagcatcctcagcaggcaccgccacaa
caacagaaccttctcagagatcagagctccaatctaactcagtctcagaggacgtctcac
acactgcagcctcctcagggagcactgcctgcatctttgtataataccatgatgatctct
cagccggcgcaggccaacgttgtgcagatctccacaagcctagcccagaacagcagcccc
agcggagccgcggttgccaccttctcacaagaccggcagatacggttccctgctgcccca
cagctcctcactaagctagtaaccggcccaatggcgtgtggtgcagttatggtgcctacc
accatgttcatggggcaggtggtgactgcgtttgccccgcagcagggccagggtcaaaca
atcagcatcacccagcagccatctgcgcagatgcaggagcagcaggctcagacgcagtca
cagacagctacaggaaccgcccaacagcaaggacaggcccaggctcagcttgcccagcag
caaacgcagttcctacagacttcctttttcctagtgggagtggagagcacttgtgtttgg
ctcatgaaattgatctggtcagtacacgttaatgtggaggaaaaatag

DBGET integrated database retrieval system