KEGG   Cyprinus carpio (common carp): 109067828
Entry
109067828         CDS       T05134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: aryl hydrocarbon receptor nuclear translocator-like protein 1
  KO
K02296  aryl hydrocarbon receptor nuclear translocator-like protein 1
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccar03000]
    109067828
Transcription factors [BR:ccar03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    109067828
SSDB
Motif
Pfam: PAS_11 PAS PAS_3 HLH PAS_9 PAS_4 PAS_2
Other DBs
NCBI-GeneID: 109067828
NCBI-ProteinID: XP_018940258
Position
Unknown
AA seq 632 aa
MADQRMDISSTMNEFISQSSADLISSSIGTTGMDYNRKRKGSTTEYQIDGFSFDDSMDID
KDKGMGRDDQHGRIKNARXGDICKEAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLD
KLTVLRMAVQHMKTLRGATNPYTEANYKPAFLSDDELKHLILRAADGFLFVVGCDRGKIL
FVSESVNKILNYTQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKT
DITPGPSRLCSGARRSFFCRMKCNRPSVKMEDKDFPSTCSKKKADRKSFCTIHSTGYXKS
WPPTKMGLDEDNEPDNEGCNLSCLVAIGRLHPHIIPQPMNGDIRVKPTEYVSRHAIDGKF
VFVDQRATAILAYLPQELLGTSFYEYFHQDDIGHLAECHRQVLQMREKINTNCYKFKIKD
GSFITLRSRWFSFMNPWTKEVEYIVSTNTVVSGSMLEGADPSYSQSASSPQSMDSVLTSG
DGGGKRPFQTVPGIPGGTRAGAGKIGRMIAEEVMEIQRIRGSSPSSCGSSPLNITATPPP
DTCSPGGKKIQNGGTPDLPSAGIVPGPDSIGYPYSNNSLMSDNSHLSIDIMEEPGSSSPS
NDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL
NT seq 1899 nt   +upstreamnt  +downstreamnt
atggcagaccaaagaatggacatctcctccacgatgaatgagttcatttcccagagttct
gcagatctcatcagcagttccattggcactacgggcatggactacaaccgcaagaggaag
ggcagcaccaccgaataccagattgatggcttttcgtttgatgatagtatggacatagat
aaagataagggaatgggaagggatgaccagcatggccggataaaaaatgccaggtgaggt
gatatatgtaaagaggctcacagtcagatagagaagagacgcagggataaaatgaacagt
tttatagatgagttggcttcgttagtccccacttgcaatgccatgtctcgcaagttggac
aaacttactgtactgcgcatggccgtccaacacatgaaaacattacgaggtgccaccaac
ccatacacagaagcaaactataagccagcattcttgtcggatgatgaattaaagcacttg
attttaagggctgccgatggctttctctttgtagttggctgcgatcgtggaaagattctc
ttcgtctcggagtctgttaataaaattctcaattacacgcagaatgatctgattggccag
agtttgttcgactacttgcatccaaaagacattgccaaagtgaaagagcagctgtcatca
tcagacacggctccacgggaacgactcatcgatgccaaaactggtctaccagtgaagact
gatatcactcccggcccctccagactgtgttcaggggcccgacgatctttcttctgtaga
atgaaatgcaaccgtccgtctgtcaagatggaggacaaggacttcccctcaacttgctcc
aaaaagaaagcagaccgcaagagtttctgtaccatccatagcactgggtacnctaaaagc
tggccgcccaccaagatgggtttggacgaggataacgaacccgataacgagggctgcaac
ctcagctgtctagtggccattggtcgcctacatccgcatatcatcccccagcccatgaac
ggcgacatccgtgtgaaacccacagaatacgtctcccgccacgctatcgatggcaagttt
gttttcgtcgaccagagggcgacagccatcctggcgtacttgccccaggagcttctagga
acgtcattttatgagtattttcaccaggatgatatcggtcacctcgccgagtgccacaga
caagtgctacagatgagagaaaagattaatacgaactgttataaattcaagataaaagac
ggctctttcatcactctgaggagccgctggttcagcttcatgaacccctggaccaaagag
gtggaatatatagtctctacaaacactgtggtttcgggcagtatgctggaaggagcagac
cctagttattctcagtcagcctcgtcccctcagagcatggacagcgttttaacatcagga
gacggtggggggaaacgtccttttcagacggttcctggtattccaggagggactagagcg
ggagctggcaagattggacgcatgatagctgaggaagtgatggagattcagaggattcga
ggctcctccccttctagctgtggctccagtcctttaaatatcactgccacgcccccacct
gacacctgctctccagggggaaagaagattcagaacggtggaactccagatctgccttca
gcaggaattgtgcctgggcctgattcgataggatacccatattcaaataactcattaatg
agtgacaactcccatctcagtattgacatcatggaagagcccggatccagcagccccagt
aacgacgaggcagctatggccgtcatcatgagccttctagaagctgatgctggcctcggc
ggtcctgtggatttcagcgaccttccttggcctttgtga

DBGET integrated database retrieval system