KEGG   Cyprinus carpio (common carp): 109072057
Entry
109072057         CDS       T05134                                 

Definition
(RefSeq) puromycin-sensitive aminopeptidase-like
  KO
K08776  puromycin-sensitive aminopeptidase [EC:3.4.11.-]
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ccar01002]
    109072057
Enzymes [BR:ccar01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     109072057
Peptidases and inhibitors [BR:ccar01002]
 Metallo peptidases
  Family M1
   109072057
SSDB
Motif
Pfam: ERAP1_C Peptidase_M1_N Peptidase_M1
Other DBs
NCBI-GeneID: 109072057
NCBI-ProteinID: XP_018943889
Position
Unknown
AA seq 744 aa
MSCRVSLSVIRLALPRSPNPIAKLVFPTLRASRLLVRFKSVSSESTLFSMPERRPFVRLP
TDVYPVNYGLRLKPDLIDFTFEGKLEAAVEVTQGTNQIVMNCADIDIITASFVPEGGEEI
NATGFNYQNEDEKVTLCFPSTLQKGSGSLKIDFVGELNDKMKGFYRSKYTIPSGEIRYAA
VTQFENVVDRKPYPEDHSLVEVKFATTPIMSTYLVAFVIGEYDFVESQSSDGVTVRVYTP
VGKAEQGRFALEVATKTLPFYKDYFSVPYPLPKIDLIAIADFAAGLYHFLTKGCDVLSFS
IPEDLWECLEQASGKPIAAVMNSWTKQMGFPIIVVDQEQHGSDRVLKISQKKFCASGPRN
DENCPNWMVPISICTSEDPSCTKLEVLLDQPETTVNITNVAPDHWLKINPGTVGFYRIQY
SSAMLESLLPGIRDLTLLPVDRLGLQNDLFSLARAGMISTVEVLKVMEAFVNEPNYTVWS
DLSCNLGVLSSLLSHTDFHEDIQEFIRDLFTPIGMKLGWDSKTGEGHLDALLRGLVLGKL
GKAGHKATLEEARRRFKEHVEGKQILPADLRSPVYLTVLKHGDSTTLDTMLKLHKQADMQ
EEKNRIERVLGAIPAPDIIQRVLNFALSEEVRPQDTVSVIGGVAGSSKQGRKAAWKFVKD
NWEELHNRYQGGFLISRLIKLTADGFAIDKMAAEVKSFFESHHAPAAERTVQQCCENILL
NAAWLKRDAEDIHQYLLQRKAPPV
NT seq 2235 nt   +upstreamnt  +downstreamnt
atgagttgtcgggtgtctctgtcagtcatacggctagccctaccccgctctccgaatcca
atagcgaagcttgtgtttccgactctccgagcaagcagactcctagtccgttttaaatcg
gtctccagcgaatcgacattattcagcatgcctgagcggaggcccttcgtgcggttgccc
actgacgtctaccccgtcaactacgggctgcgcctcaagcccgacctcatcgacttcacc
ttcgagggcaaactggaggcagccgtggaggttacacaagggacaaaccagattgtgatg
aactgtgctgatatagacataattactgcttcttttgtgcctgaagggggggaagaaatt
aacgctacaggatttaactatcagaacgaggatgagaaggtgactctttgtttccccagc
actctgcaaaaagggtcgggatcgttgaaaatagactttgtgggagagctgaacgacaaa
atgaaaggcttctataggagtaaatacacgattccttcaggagaaatccgctacgctgct
gtcacacagtttgagaatgttgttgatcgaaagccatatccagaggatcacagtctggtg
gaggtgaagtttgccactacacccatcatgtccacctacctggtggcgtttgtcattggc
gagtatgattttgtggagagtcagtcatcagatggtgtgacggtccgtgtgtacactcct
gttggaaaggcagagcaagggagatttgcactggaggttgctacaaagacccttccgttc
tacaaagactatttcagcgttccttatccgttgcctaaaattgatctaattgctattgct
gattttgctgctggtttgtatcattttctaactaaagggtgtgacgttctctctttctca
atcccagaggacctatgggagtgtttggagcaagcaagtgggaaacctattgctgcagtg
atgaattcctggaccaaacaaatgggattccctattatagtagtggatcaagagcagcat
ggcagtgaccgagtgctgaaaatctctcagaagaagttctgtgctagcggaccacgtaat
gatgagaactgccccaattggatggttcccatcagtatctgcactagtgaggacccgagc
tgcaccaagctggaggtcctgttggaccagcctgaaaccacagttaacatcaccaacgtt
gcacctgatcactggctcaagattaatccaggtaccgtgggattctacaggatccagtac
agctctgccatgctggaaagtttgcttcctggtatccgtgacctcacactgctgcctgtg
gaccgcctgggtctgcaaaacgacctcttctccctggctcgagcaggtatgatcagtact
gtggaggtgttgaaggtgatggaagcatttgtgaatgagccaaactacacggtgtggagt
gacctgagctgtaatctgggtgttctgtcctctctgctctcacacaccgacttccacgag
gacatccaggagttcatccgagatctcttcacccctatcggcatgaagctgggctgggac
agtaaaaccggagaggggcatttggacgccctgctgcggggtctggtgctggggaagctg
ggtaaagcggggcataaggccacactggaggaggctcggcggagattcaaagaacacgtg
gagggtaaacagatcctgcctgcagacctcaggagtccagtatacctaacagttctgaag
cacggagacagcacaacacttgacaccatgctcaagcttcacaagcaggcagacatgcag
gaggagaagaaccgcatcgagagagtgctgggagccattcccgcccctgacatcatccag
agagtgcttaactttgccctgtcggaggaggttcgtccccaggacacagtgtctgtaatc
gggggcgtagctggaagcagcaaacaggggcgcaaagctgcatggaaatttgttaaggac
aactgggaagaacttcataaccgttaccagggcggcttcctcatatcaagactcatcaag
ctgacagcggatgggtttgcaatagataaaatggctgctgaagttaagagcttctttgaa
agtcatcacgcgccagcggccgagcgcacggtacagcagtgctgcgagaacattctcctg
aacgctgcctggctcaagagagacgcagaagacatccaccagtacctgctgcagaggaaa
gcgccccccgtctga

DBGET integrated database retrieval system