KEGG   Cyprinus carpio (common carp): 109073470Help
Entry
109073470         CDS       T05134                                 

Definition
(RefSeq) phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha-like
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00562  Inositol phosphate metabolism
ccar01100  Metabolic pathways
ccar04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    109073470
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    109073470
Enzymes [BR:ccar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     109073470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase DUF4135
Motif
Other DBs
NCBI-GeneID: 109073470
NCBI-ProteinID: XP_018945134
Position
Unknown
AA seq 149 aa AA seqDB search
MFKVGEDLRQDMLALQMIRIMDRIWLQEGLDLRIVNFKCISTGKDKGMVELVPSSETLRK
IQVENGVTGSFKDKPLAEWLRKYNPAEDEYEKASENFIYTCAGCCVATYILGICDRHNDN
IMLRSTGHMFHIDFGKFLGHAQMIGSFKR
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaggttggagaggatctgaggcaggacatgttggcgctgcagatgattcggatt
atggataggatctggctgcaggagggactggacctgcgcattgtcaacttcaaatgcatc
tctactggaaaagataaaggcatggtagagttggttccgtcttctgaaacgctgaggaag
attcaggtggagaacggagtgacgggctcctttaaggacaaacctcttgccgagtggctc
cgcaagtataaccctgctgaggatgaatatgaaaaggcctcagagaatttcatctacacc
tgcgccggatgctgcgtggccacttacatcctaggcatttgtgaccgtcacaacgataac
atcatgctgcgttccaccggccacatgttccacatagactttgggaagttcctgggtcac
gcacaaatgattgggagttttaaaaggtga

DBGET integrated database retrieval system