KEGG   Cyprinus carpio (common carp): 109074166Help
Entry
109074166         CDS       T05134                                 

Definition
(RefSeq) vacuolar protein sorting-associated protein 33A
  KO
K20182  vacuolar protein sorting-associated protein 33A
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109074166
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccar04131]
    109074166
Membrane trafficking [BR:ccar04131]
 Endosome - Lysosome transport
  Tethering complex
   CORVET complex
    109074166
   Hops complex
    109074166
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec1 Mrpl_C DUF1629
Motif
Other DBs
NCBI-GeneID: 109074166
NCBI-ProteinID: XP_018945749
Position
Unknown
AA seq 599 aa AA seqDB search
MASHLFCGRVNLNILREAARKDLREFLDKCSGSKAIVWDEYLTGPFGLIAQYSLLKEHEV
EKMFTLKGGRIPSAAVKNIVFFVRPRLELMDIIAENVASEDKLKPREFHILFVPRRSLLC
EQRLKEKGVLNSFTNIDEYILDLIPYDGDLLSMESESSFRECYLENDQTSLYHAAKGLMT
LQALYGTIPQIFGKGECARHVANMMLRMKREFAGSHTQILPVFDTLLLLDRNVDLLTPLA
TQLTYEGLIDEIYGITNGYVKLPPEKFAQKKQGEGGKDLPTEPKKLQLNSAEELYAEIRD
KNFNAVGAALSKKAKIISAAFEERHNAKTVGEIKQFVSQLPHMQAARGSLANHTSIAELI
KDITISEDFFDSLTVEQEFMTGVDTDKVSTYIEDCIAQKDPLIKILRLVCMQSVCNNGLK
QKVLDYYKKEILQTYGYKHNLTLKNLEKVGLLKPQSTMRNNYPTIRKTLKLWMEDANEQN
PNDISYVYSGYAPLSVRLTQVLARPGWRSIEEVLKILPGPHFEERQQVPTGLHKKRQPGE
NRTTLVFFLGGVTYAEIAALRFLSHMEDSGTEYIIATTKLINGTSWIKSLMDNPEENLP
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcacatttgttttgcggcagagtaaacctaaatatcttgcgagaagctgcgcga
aaagacctccgcgaatttttagataaatgttctggaagcaaggccatcgtttgggacgag
tatcttactggacctttcggcttaattgctcagtattcccttttgaaggaacatgaagtc
gagaaaatgttcaccctcaaaggtggtcgtataccatccgctgctgtcaagaatattgtc
ttttttgttcgaccaaggttggaactgatggacatcattgcagaaaatgttgcaagtgag
gataaattaaaaccacgagaattccacatcctgtttgtgcctcgccggagcctcctgtgt
gagcagcggctgaaagagaaaggggttctgaactcgttcacaaacatcgatgaatacatt
ctggacctcataccttatgatggagatcttctttccatggagtctgagagttccttcaga
gagtgttatttagagaatgatcagacaagcctgtatcatgctgccaagggcctcatgact
ttgcaagctctttatggaacaataccacaaatctttggcaaaggcgagtgtgcgagacat
gtggccaacatgatgttgcggatgaagagagagtttgcaggcagtcatacgcaaatcctg
cctgtttttgataccctcctcctgttggatcgcaacgtggatttgcttacgccgttagcc
acccaacttacctatgagggtcttatcgatgagatctatggcatcaccaatggttatgtg
aagcttccacctgagaagtttgcacagaagaaacagggagaaggtgggaaagatctcccc
actgagccgaaaaaactgcagctcaactcagccgaggagctttatgctgaaatacgggac
aagaacttcaatgctgtgggagcggctctcagcaagaaagccaagattatatcagctgcg
tttgaggagcgacacaatgcaaaaactgttggagagattaaacagtttgtttcccagttg
cctcacatgcaggcagctcgaggttccttggctaatcacacctctattgctgaactcatt
aaggacattacaatttcagaagacttctttgacagtctgactgttgaacaagagtttatg
actggagtagacacagacaaggtcagcacatatatagaagactgcatagcacaaaaagac
cctctgataaaaatcctgcgactggtgtgcatgcagtctgtctgcaacaacggcctcaaa
cagaaagtcctggactactataagaaggagatccttcagacatacggttacaagcacaat
ctgaccctcaagaacttggaaaaggttgggttactcaaacctcaaagcaccatgagaaac
aactaccccacaatcaggaaaacgctcaaactgtggatggaggatgcaaacgaacagaac
cccaatgacatctcgtatgtgtacagtggctatgcgccactcagtgttcgtctgacacaa
gtgctcgcacgtcctggttggaggagcatagaggaggtgctgaagattttgcctggtcca
cactttgaagaaagacagcaggttcccacaggccttcacaagaaacgtcagccaggagaa
aacagaaccacccttgtcttcttccttggcggtgtgacgtatgctgaaatcgctgctcta
cggtttttgtctcatatggaagatagtgggactgagtacattattgcaaccaccaaactt
atcaatggcaccagctggataaagtctctcatggacaatcctgaggaaaacttaccttaa

DBGET integrated database retrieval system