KEGG   Cyprinus carpio (common carp): 109074435Help
Entry
109074435         CDS       T05134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: cytosolic phospholipase A2 zeta-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00564  Glycerophospholipid metabolism
ccar00565  Ether lipid metabolism
ccar00590  Arachidonic acid metabolism
ccar00591  Linoleic acid metabolism
ccar00592  alpha-Linolenic acid metabolism
ccar01100  Metabolic pathways
ccar04010  MAPK signaling pathway
ccar04217  Necroptosis
ccar04270  Vascular smooth muscle contraction
ccar04370  VEGF signaling pathway
ccar04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    109074435
   00565 Ether lipid metabolism
    109074435
   00590 Arachidonic acid metabolism
    109074435
   00591 Linoleic acid metabolism
    109074435
   00592 alpha-Linolenic acid metabolism
    109074435
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109074435
   04370 VEGF signaling pathway
    109074435
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109074435
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    109074435
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    109074435
Enzymes [BR:ccar01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     109074435
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2 cPLA2_C2
Motif
Other DBs
NCBI-GeneID: 109074435
NCBI-ProteinID: XP_018946014
Position
8
AA seq 844 aa AA seqDB search
MLKKEVKPYWNLSVKILYAKIHQTYDYLSSSDCYVILNLPTASALTNRTKTISNSDNPEW
NETFTFRVHSNIKNILEILIYDEDPLMRDDHCATILFDINNLTPGKKETKCFIINDKTKD
ELWVEFEITKSSETPSPCFSNGVLVAGPFCELNVKIDKLLKKTEATQNIFFKLKGAYKED
FMISNSEESSNFLKTLRYYINRDLETELNLTSEIVVSPENVGTVVVDAALSDPVDIELTS
IPLKPLPSKQQITISLPLGENNVDLQLKTDDRSDEELDVRLDFDIPVEEKNFLVKRKKVV
SQALQKALSLSSAPEPSKVPVVAVVCSGGGSRALTSTYGSLKGLQKIQLLDAVSYITGVS
GATWALGSLYGDPNWSKGGIDKSMESVKKELSKNVLSMFSSEQLQEYKQRMEEREKXGFL
VSLIDMWGLALEYLFQGKKHMGTLSEMQRTVSEGQNPLPIFTAVNLKNGKTESITDAEWC
EFTPYEVGFPKYGAFIPAQNFGSEYYLGHMVKKLPETGLSFLVGMWSSIFSINLTDIWRI
ATGVTPSWTPYVGGGVSNTETDSKPTALGTYLISPVTDFAKMLCGFMTSRPIVSQMYNFL
RGFNLHNSYNENTGFITWKDTHPDAFPNSMTPADPVLSLVDAGIAVNAGFPPVVRSHRHV
DVILSLNYSWERDRFKVIKQTQEYCTDRKIPFPKIDFQKVESEPLKEVYVFEDKENPEVP
IVLHFPLANVSFKQFKSPGVKREGDKEWKEGAVDVEFNSNTSPYLSHKLTYTPEDFHRLI
NLTSYNIQNNKDVILNALNKTLNRNRQRQTGDSHTTKEKAAVRKTSSMSTPKARPQKTRK
TEAP
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagaaagaagtcaagccatactggaatttgtcagtcaaaatcttatatgcgaag
atccatcagacctatgactacttgtcttcatctgactgctatgtcatcctaaacttaccc
acggcatcggccctaacaaatcgcaccaagactatctcaaatagcgacaaccctgaatgg
aatgaaactttcaccttcagggtgcacagcaacatcaagaacattctagagatcttgatc
tatgatgaggatccattaatgagggacgaccattgtgccactatcctatttgacatcaat
aacctcacacctgggaaaaaggagaccaaatgctttataataaatgataagaccaaggat
gaactgtgggtagagtttgagatcactaagagctctgagacaccaagcccatgtttctct
aatggagttttggtggcaggtcctttttgtgagctgaatgtgaagatagacaagcttcta
aagaagactgaagcaacgcagaacatattttttaaactgaaaggggcatacaaagaggat
ttcatgatctcaaattctgaggaaagctccaacttcctgaaaacattacgttactacatc
aaccgagacctggaaactgaactcaatctgacctctgagattgttgtcagcccagaaaat
gttgggacagtagtagtggatgctgctctttcagaccctgtagacattgaattgacttct
atccctttaaaaccattaccatccaaacaacaaattactatctctttgcctctgggagag
aataatgttgatctccaactgaaaacggacgatcgctctgatgaagagctggatgtgcgt
ctggattttgatatcccagtggaagaaaagaattttctggtgaagagaaaaaaagtcgtg
tcacaggctctacagaaagctctgagtctcagttctgcacctgagcccagcaaggtccca
gtggtggctgtggtgtgttctggtggtgggagcagagcgttaacaagcacatatggtagc
cttaagggtctgcagaagatccagcttcttgatgcagtcagctacatcacaggggtttca
ggtgccacttgggctctaggctctctttatggagaccctaactggtcaaagggtggcatt
gataagtctatggagtctgtaaagaaggagctctctaaaaatgtgctcagtatgttttcc
tcagagcagctacaggaatacaaacagaggatggaagagcgagagaaanaaggattcctt
gtatctctcatcgacatgtggggtctggctttagagtaccttttccaagggaagaaacac
atgggtactctatctgaaatgcagagaacagtgtctgagggccagaaccctctacccata
ttcacagctgttaatctgaagaatggcaaaacagaaagtataacagatgcggaatggtgt
gaattcaccccatatgaggttggatttccaaaatacggtgcctttatacctgcgcagaac
tttgggagtgaatattacctcggtcacatggtcaagaaactccctgaaactgggttgtct
tttcttgtgggaatgtggagcagcattttctctataaatctgacagatatctggcgtatt
gccacaggagtcaccccttcttggacgccttatgttggaggaggagtgagtaacacagag
actgatagtaaaccaacagcacttggcacatacctgatcagccctgtgactgactttgct
aaaatgctgtgtggctttatgaccagccgccccattgtcagtcagatgtacaacttcctg
agaggcttcaacctgcacaacagctacaatgagaacacgggcttcatcacatggaaagac
acacacccagatgcctttcctaactccatgactccagctgatcctgttctgagtttagta
gacgctggaattgctgtaaatgctggattcccccctgtggtgcgctctcacagacatgtg
gatgttattctgtctctaaactactcctgggaacgagatcggtttaaggtaattaagcaa
actcaggagtactgcactgatcgcaagattccatttccaaagattgatttccaaaaggtg
gagtccgagccactgaaggaagtttatgtgtttgaggataaagagaatccagaggttccc
atagtgcttcactttcccctggccaatgtctcattcaagcagttcaagtctcctggagtg
aagagagagggagataaggagtggaaggagggagcggttgatgttgaatttaacagtaac
acctccccatatctctctcacaaactgacttacacaccggaggacttccataggctcatc
aacctcacctcctacaacatccaaaacaacaaagacgtcattttgaatgcactaaacaaa
acacttaaccgaaacagacaaaggcagaccggtgatagccacaccacaaaggagaaggcg
gcagtaagaaagaccagttcaatgtcaacaccaaaagcaagaccacaaaaaacaagaaag
actgaagcaccgtga

DBGET integrated database retrieval system