KEGG   Cyprinus carpio (common carp): 109074621
Entry
109074621         CDS       T05134                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00230  Purine metabolism
ccar00240  Pyrimidine metabolism
ccar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109074621
   00240 Pyrimidine metabolism
    109074621
Enzymes [BR:ccar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     109074621
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 Thymidylate_kin AAA_28 AAA_17
Other DBs
NCBI-GeneID: 109074621
NCBI-ProteinID: XP_018946178
Position
Unknown
AA seq 264 aa
MATPPKRLCSSFDADLSFEKRALKISIEGNIAAGKSTFVRLLERASEEWEVIPEPIGKWC
NVQTTENEYEELSTSQKSGGNLLQMLYDKPSRWSYTFQTYACLSRVRAQLQPPSAKLQQA
EQPVQFFERSVYSDRYVFASNLFESGDLNETEWAIYQDWHSWLLTQFESQIELDAMIYLR
ADPERCMQRLQFRGREEEQGIPLDYLEKLHYKHECWLYNRTTKLDFEYLKDLPILLLDVN
EDFKNDRIKQEGIIDKVKEFLSTL
NT seq 795 nt   +upstreamnt  +downstreamnt
atggctactcctcccaagagattgtgttcaagctttgacgctgacctcagtttcgaaaaa
agggcattgaagatctcaatagagggaaacattgcggcagggaagtcaacttttgtgcgt
ttgttggagcgggcgtcagaggagtgggaggtcataccagagcccattgggaagtggtgc
aatgtacaaaccacagagaatgagtatgaggagctcagcacgtcgcagaagagtggaggc
aacctgctgcagatgttatatgacaagcccagtcgctggtcttacactttccagacctac
gcctgcttgagtcgtgtccgtgcacagcttcagcctccttctgccaaacttcagcaggca
gagcaaccggtccagttctttgagcgctcggtctacagcgatcgatatgtgtttgcctct
aacctctttgagtctggagatctgaatgagaccgagtgggccatttatcaagactggcat
tcgtggctcctcactcagtttgagtcccagattgagcttgatgccatgatctatcttcgt
gctgatcctgagaggtgtatgcagcgtcttcagttcagaggacgagaggaggaacaaggg
attcctctggattacctggagaagctgcattataagcatgagtgttggctgtacaatcga
accacaaagttggattttgagtatcttaaagaccttccaatactgctcctggatgttaat
gaggattttaaaaatgacagaattaagcaagaaggtattattgataaggtgaaggagttt
ttaagcaccctctag

DBGET integrated database retrieval system