KEGG   Cyprinus carpio (common carp): 109076966Help
Entry
109076966         CDS       T05134                                 

Definition
(RefSeq) autophagy-related protein 16-like
  KO
K17890  autophagy-related protein 16-1
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04136  Autophagy - other
ccar04140  Autophagy - animal
ccar04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109076966
   04136 Autophagy - other
    109076966
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109076966
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccar04131]
    109076966
   03029 Mitochondrial biogenesis [BR:ccar03029]
    109076966
Membrane trafficking [BR:ccar04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    109076966
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    109076966
Mitochondrial biogenesis [BR:ccar03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    109076966
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 KASH_CCD DUF4472 Fez1 ADIP Seryl_tRNA_N Mobilization_B ERM CtIP_N DUF4407 Lebercilin YabA Myosin_tail_1 DUF4618 APG6_N Spc7 Golgin_A5 V_ATPase_I ATP-synt_D USP8_interact DUF1664 PhoU Lectin_N Lipoprotein_6 TPR_MLP1_2 FUSC CENP-H
Motif
Other DBs
NCBI-GeneID: 109076966
NCBI-ProteinID: XP_018948160
Position
Unknown
AA seq 153 aa AA seqDB search
MAQMRIKHQEELSELHKKRGELAQSVIELNNQIQQKDKEIQSNEAKMLEYQQQVSHLEGE
GRELRNSLADLERANQTLRDEYDALQITFSALEEKLRKTTEDNQELVTRWMAEKAQEANK
LNAENEKDSRSQTHSIWMLLKYAFFCTRFKVPC
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggctcagatgagaatcaaacatcaagaggagctgtcggagctgcacaagaaacgagga
gagttggcccagagcgtgattgaactaaacaaccagattcagcagaaagacaaagagatc
cagagtaatgaagccaagatgctggagtatcagcagcaggtctctcatctggaaggagag
ggtcgcgagctccgcaactctctggccgatctggaacgagccaatcagacgctgcgagat
gagtacgacgccctgcagatcacgttcagcgccctggaggagaaactacggaaaaccaca
gaggacaatcaggagctggtgacacgctggatggccgagaaagcgcaggaggccaacaaa
ctcaacgctgagaacgagaaggactccaggtcacaaacacattcaatctggatgcttcta
aaatacgctttcttttgtactcgctttaaggttccctgttaa

DBGET integrated database retrieval system