KEGG   Cyprinus carpio (common carp): 109077373Help
Entry
109077373         CDS       T05134                                 

Definition
(RefSeq) alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase-like
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00510  N-Glycan biosynthesis
ccar00513  Various types of N-glycan biosynthesis
ccar01100  Metabolic pathways
Module
ccar_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    109077373
   00513 Various types of N-glycan biosynthesis
    109077373
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ccar01003]
    109077373
Enzymes [BR:ccar01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     109077373
Glycosyltransferases [BR:ccar01003]
 Glycan extension
  N-Glycan
   109077373
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2
Motif
Other DBs
NCBI-GeneID: 109077373
NCBI-ProteinID: XP_018948503
Position
Unknown
AA seq 454 aa AA seqDB search
MRFRIYKRKVVILTLVVVICGFAVWNNGKPKKASAAVFPKEAETGKRSSIGGQEQIHVTI
PVTRKTVNETLPEKQQLQLQAVPKSEADNTTLVYRGIVFQLNFDQTLRNEEKFRSVRQKD
DLVVVVQVHNRPEYLRLLVDSLRKAEGIENVLLIFSHDFWSPEINRIVASVDFCLVLQIF
FPFSIQLYPQEFPGNDPRDCPRDIPKKDALTLGCLNAEYPDSFGHYREAKFSQTKHHWWW
KLHFVWDRVRVLKEHRGLLLLIEEDHYLVPDFYHLLKHMVSLKKEQCPDCDILSLGSYGH
VSYSSKANKVEVKAWKSTEHNMGMALSRDTYQKLLRCTDAFCTYDDYNWDWSLQHLTVTC
LPTFLKVMVSEAPRIFHAGDCGMHHKKSSCMPSSQKTKIENILQSSRNQLFPKQLLITKR
LPASGAKGVAPHVKNGGWGDIRDHELCKSYLRLQ
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgagattccgaatttacaagcgaaaggtggtaatactgactctagtggtggtcatctgc
ggattcgccgtctggaataacgggaaaccgaagaaggcgagcgccgcagtgtttcccaaa
gaggcggaaacgggtaaacggagcagcattggtggtcaggaacaaatacatgtcacgatc
ccagtaacacgtaaaactgtcaacgaaactcttccggaaaaacaacagttacaactacag
gcagttcccaaatctgaagcggacaacacaactctggtgtacagagggatcgtctttcaa
ctcaacttcgaccagacgcttagaaacgaggagaagtttcgttccgtgcgccagaaggac
gacctagtcgtcgtcgtccaagttcacaaccgtcccgaatacctacgcctcttggtggac
agcttgagaaaagcggaaggaatcgagaacgtcttgctgatattcagccacgacttctgg
tcgccggaaatcaaccggatagtcgcgtccgtcgacttctgcttggtcctccagatattc
ttccccttcagcatccagctctatcctcaagagttccccgggaacgaccccagagactgc
cctcgggacattcccaagaaagatgccttaaccctaggctgcttaaacgcagagtacccg
gactccttcggacactatcgggaagccaagttctcgcagaccaaacaccattggtggtgg
aagctccacttcgtttgggatcgagtccgagtcttgaaagagcaccgaggactcttattg
ctcatcgaggaggaccactacctcgtcccagacttctaccatctactcaaacacatggtg
tccctcaagaaagagcagtgtcccgactgcgacatcttgtctctgggaagctacggacac
gtcagctactccagcaaagccaataaagtggaggtgaaagcatggaagtccaccgagcac
aacatgggaatggcgctgagcagagacacctaccagaaactcctcaggtgcaccgatgcc
ttctgcacctacgacgactataactgggattggtcgctgcagcaccttaccgtgacttgt
ctgcccacgttcctgaaggtcatggtcagcgaggcgccacgcatcttccacgccggagac
tgcggcatgcaccacaagaagtcgtcgtgcatgccatccagccagaagacgaagatcgag
aacattctccagagcagcaggaaccagttattccccaaacagctgctcattacaaagaga
ctcccagcttctggagccaaaggagtggctccgcacgtcaaaaacggaggttggggagac
atcagggaccacgaactctgcaagagctaccttcgattgcaatga

DBGET integrated database retrieval system