KEGG   Cyprinus carpio (common carp): 109077571Help
Entry
109077571         CDS       T05134                                 

Definition
(RefSeq) serine/threonine-protein kinase WNK2-like
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccar01001]
    109077571
   01009 Protein phosphatases and associated proteins [BR:ccar01009]
    109077571
Enzymes [BR:ccar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109077571
Protein kinases [BR:ccar01001]
 Serine/threonine kinases: Other
  Wnk family
   109077571
Protein phosphatases and associated proteins [BR:ccar01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109077571
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OSR1_C
Motif
Other DBs
NCBI-GeneID: 109077571
NCBI-ProteinID: XP_018948669
Position
Unknown
AA seq 957 aa AA seqDB search
MIHHNDWDPFAALLGNVVVQAMVNAQGVLTSHSQTVHVDQNSSSSSDHRPRPTAAFNATS
RPPTRTVLTSHSQTVHVDQNSSSSSDHVCVSQMMTHLTPAPALSSSDPSHSSLNAPQPPT
VPQLLSFRPVLDTLGSAVPVDPNQAPPQYSSPASLSSVPHSGASTSLSQQHSSVTPAQQQ
HSTTEVCSEEHVPDKQTAAARSTYDSINSDATSGKEMSDGNEGSGRARSESRVRKPSRKT
SRTRSRQDKINRPKLNMIKVCDTGDKMVECQLETHNHKMVTFKFDLDGDAPEEIATYMVE
NEFILLLEREMFIEQLKEIMDKAEDILNEDAEGEKTSVQTSVLRQTPVAADSGPQGSKPE
HMQSDQLVYKQNVLHTGRRWFIICPVAETAAPDGEEAAANPESSSTSQTQDVNTAGAKPL
QKRPLVPQASLSEVAPSAKGPQAACAAVVPDIPCCPIVPPVSLDVSAQKAAGVPQQPVAY
TSSPGAEPPISQTQTPPVVLLQPFATPTPQASVSSGQSQPQSPTHQPQSPTHQPQSPTHQ
PQSPTHQPQNAPPLQPGESDGEGPPRLEFADRTIKTLDEKLRNLLYQEYHPSQTTSSASE
PPGSPPLSGSQGSDGAVRKAEKLPQIPERSDSLGTLSDSAVAPFKRLLTRKDSGSASDTH
TSKSHFQIVPTDSDVSSHDGGDHVIDLESAAVPVIQNGHRSTSKSQSNRYSAPPDLYQDT
TTSFSEARPTMPCAQSSLSADGMVQCLSSDTGEEDQSETLSTKPSSLAPAQSESGGGDFM
KRAVAFLRRSGHNSSVQSSDSPPCPLVNGHAHSVSGHAHSAYISSDNDSELEDADMKREL
QKLREKHMKEISELQAHQRGEIEQLYSRLGRPVPPSMGFLHAVPPTGRRRRASKHKLKGS
RLLNPMVQHLRNNRSNPSSMYARVCVSRSTSFKITDTNIFWTPEEHGQENAIWLLLN
NT seq 2874 nt NT seq  +upstreamnt  +downstreamnt
atgattcatcacaacgactgggatccatttgcagctttattaggaaacgtggtcgtacaa
gccatggtcaatgcacagggagtcttgaccagccattcccaaactgttcacgtggaccag
aactcgtccagtagctccgatcatcgtccccgtcccacagcagcctttaatgccacctca
cgccctcccactcgtaccgtcttgaccagccattcccaaactgttcacgtggaccagaac
tcgtccagtagctccgatcatgtctgtgtttctcagatgatgacacacctgactccagct
cctgccctgagctccagcgacccgtcccacagcagccttaatgcacctcagcctcccact
gtaccgcagctcttgtccttcagacccgtcctcgacacactgggctctgctgtgcccgtg
gacccaaaccaggctcctcctcagtactccagcccagcctctttatcaagcgtcccacat
tcaggagccagtaccagcctgagccagcagcacagcagtgttacgccagcgcagcagcag
cacagcaccactgaagtatgctctgaggagcatgttcctgataaacagaccgcagcagct
aggtccacgtatgacagtataaactcagatgccacatccggtaaagagatgagcgatggg
aacgagggctccggcagagctcgcagtgagtcacgagtgcgaaaacccagtcgcaaaacg
tcccgcacgcgctcccgccaagacaagatcaacagacccaaactcaacatgatcaaagtg
tgtgacacaggagacaagatggtggagtgtcagctggagactcataaccataagatggtc
acatttaaatttgaccttgacggagatgctccagaggagattgccacatatatggttgag
aatgagtttattctgttgctggagagggagatgttcatcgagcagctgaaggagatcatg
gataaagctgaggacattctgaacgaggacgctgagggtgagaagacctctgtccagacc
tcagtgctccgtcagacgcctgtcgcagcagactccggcccgcaggggtcaaaacctgag
cacatgcagtctgaccagctcgtctataaacagaacgtgcttcacaccggaaggcgctgg
ttcatcatctgtcctgtggcggagacggccgcgcctgatggagaagaggccgccgcgaac
ccagagagctcctctacatctcaaacgcaggatgtgaacacagccggtgccaaacctctg
cagaaacgaccattggtgccacaggcgtccctctctgaggttgctccgtcggccaagggc
cctcaggctgcctgcgcagctgtggttcctgacatcccatgctgccccattgtgcctcct
gtttcgctggacgtctctgctcagaaagcggcgggggtccctcagcagccggtcgcttac
accagcagccctggcgcggagccgcccatcagccagacccagaccccgcccgtggtgctg
cttcagccctttgccacgcccactccacaggcttcagtcagcagcggccaatcacagcct
cagagccccacccatcagcctcagagccccacccaccagcctcagagccccacccaccag
ccccagagccccacccatcagccccagaacgccccgcccctgcagccaggtgaatcggat
ggggaagggccgcccaggctggagtttgcagacagaacgataaagactctggatgagaaa
ctgagaaaccttttgtaccaagagtaccacccctcgcaaaccacaagctccgcctccgag
ccgcccggatcacctccgctgtccggcagtcagggcagtgacggtgccgtgaggaaagca
gaaaaactgccgcagattccagagagatccgacagtctcgggaccttgagtgattctgct
gtcgcccccttcaaaagacttctgaccagaaaagactccgggtccgcttctgatacacac
acatccaagagccacttccagatagtgccaacagattcagacgtgtcttctcacgatggt
ggagatcacgtgattgatcttgaatctgcagctgttcctgtaatccagaacggacacaga
tccacatcgaagtcacaaagcaaccgttactcggcacctcctgacttatatcaggacaca
actacttccttttcagaggccagacccacaatgccttgcgctcagagctcgttgtcagcg
gacgggatggtgcagtgcttgtcctcggacaccggagaggaggatcagagtgagactctg
tccactaagccctcgtctctggctcctgcccagtcagagtcaggcggcggggacttcatg
aagcgggcagtggcgttcctccggcgctcgggacacaacagcagcgtccaaagctccgac
tcgcccccttgtcctctggtgaatggacacgcccattcggttagcggccacgcccactcc
gcttacatcagcagtgataatgactctgagcttgaggacgctgatatgaaacgagaactg
cagaagctgagagagaagcacatgaaggagatctccgagcttcaggctcatcagagagga
gagatcgagcagttgtactctcggttaggtcgaccagttcctcccagcatgggcttcttg
catgcagtgccgcctacaggccgtcgccgcagagcctccaaacacaagctgaagggtagc
cgactgctcaatcccatggtgcaacatcttaggaacaaccgaagcaacccctctagtatg
tatgcaagagtttgtgtgagccggagtaccagctttaaaatcacagacaccaatatattt
tggacccctgaggaacatggccaagagaatgctatctggcttctgttaaattaa

DBGET integrated database retrieval system