KEGG   Cyprinus carpio (common carp): 109079214Help
Entry
109079214         CDS       T05134                                 

Definition
(RefSeq) exportin-5-like
  KO
K14289  exportin-5
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar03013  RNA transport
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    109079214
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ccar03016]
    109079214
   03036 Chromosome and associated proteins [BR:ccar03036]
    109079214
Transfer RNA biogenesis [BR:ccar03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    109079214
Chromosome and associated proteins [BR:ccar03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     109079214
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 109079214
NCBI-ProteinID: XP_018949944
Position
Unknown
AA seq 175 aa AA seqDB search
MVSVDSSQGIQMNTPSDELSELGKCLLQSEDIYMTLLAICFNSLSWEDTINCQRSASVLC
WTLLKQVLGCNLLPEAVTWLYTSVLKGLQMHGQHEGCNAALTQLALLIYESLRPRYAELR
FIMNQIPDIHVEALEQFDQKTIQSTVSKAGEKKKKEQFKRLIAGTVGKNGMMERK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcagtggactcctcacaaggaattcaaatgaatacaccttcagatgagctctca
gaattgggcaagtgccttctccagagtgaggatatatatatgactctcctggcaatatgt
tttaactccctttcctgggaggacacaataaactgtcaacggagtgctagtgtgctttgc
tggactttgctaaaacaggtgcttggctgtaacctgctcccggaggctgtgacgtggctc
tacaccagtgtacttaagggtttacagatgcatggacaacacgagggctgcaatgctgcg
ctaactcagctggccttgctcatctacgagtctctaaggcctagatatgctgagctgcgt
tttatcatgaatcagatccctgatatccatgttgaggccctggaacaatttgatcagaag
accatacaatccactgtatcaaaggcaggggagaagaaaaagaaggagcaatttaaaagg
ctcattgcaggcactgttgggaagaatggcatgatggagcgtaaatga

DBGET integrated database retrieval system