KEGG   Cyprinus carpio (common carp): 109079543Help
Entry
109079543         CDS       T05134                                 

Definition
(RefSeq) mitogen-activated protein kinase 10-like
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04012  ErbB signaling pathway
ccar04068  FoxO signaling pathway
ccar04137  Mitophagy - animal
ccar04140  Autophagy - animal
ccar04141  Protein processing in endoplasmic reticulum
ccar04210  Apoptosis
ccar04217  Necroptosis
ccar04310  Wnt signaling pathway
ccar04510  Focal adhesion
ccar04530  Tight junction
ccar04620  Toll-like receptor signaling pathway
ccar04621  NOD-like receptor signaling pathway
ccar04622  RIG-I-like receptor signaling pathway
ccar04625  C-type lectin receptor signaling pathway
ccar04910  Insulin signaling pathway
ccar04912  GnRH signaling pathway
ccar04914  Progesterone-mediated oocyte maturation
ccar04920  Adipocytokine signaling pathway
ccar04933  AGE-RAGE signaling pathway in diabetic complications
ccar05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109079543
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109079543
   04012 ErbB signaling pathway
    109079543
   04310 Wnt signaling pathway
    109079543
   04068 FoxO signaling pathway
    109079543
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109079543
   04137 Mitophagy - animal
    109079543
  09143 Cell growth and death
   04210 Apoptosis
    109079543
   04217 Necroptosis
    109079543
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109079543
   04530 Tight junction
    109079543
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109079543
   04621 NOD-like receptor signaling pathway
    109079543
   04622 RIG-I-like receptor signaling pathway
    109079543
   04625 C-type lectin receptor signaling pathway
    109079543
  09152 Endocrine system
   04910 Insulin signaling pathway
    109079543
   04920 Adipocytokine signaling pathway
    109079543
   04912 GnRH signaling pathway
    109079543
   04914 Progesterone-mediated oocyte maturation
    109079543
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109079543
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109079543
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccar01001]
    109079543
Enzymes [BR:ccar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     109079543
Protein kinases [BR:ccar01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   109079543
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase
Motif
Other DBs
NCBI-GeneID: 109079543
NCBI-ProteinID: XP_018950236
Position
Unknown
AA seq 167 aa AA seqDB search
HPHSDIDQWNKVIEQLGTPSPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDCLFPADSE
HNKLKASQARDLLSKMLIIDPAKRISVDEALQHPYINVWYDPAEVEAARNQPISMPPPQI
YDKQLDEREHSIDEWKELIYKEVMNFEERTKNGVVKGQPSPSGTLCA
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
cacccacattcagacattgaccaatggaataaggttatagagcagcttggcacgccctct
cctgagttcatgaagaaattgcagccaacagtgcgtaactacgtggagaacaggccaaaa
tacgccggcctgaccttccccaaactcttccctgattgcctcttccctgcagactcggag
cacaacaaactcaaagctagtcaggccagagacctgctgtctaagatgttgatcattgat
cccgctaagcggatatcagtggacgaggccctgcagcacccctacatcaacgtgtggtac
gacccggccgaggtggaggcagccaggaatcagccgatatctatgcctcctccacagatc
tatgataaacagctagatgagagggaacactcgattgatgaatggaaagagctcatctat
aaagaggtgatgaacttcgaggagagaacaaagaatggtgtggtgaagggacagccctct
ccctcaggtactctctgtgcataa

DBGET integrated database retrieval system