KEGG   Cyprinus carpio (common carp): 109079646Help
Entry
109079646         CDS       T05134                                 

Gene name
dlat
Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00010  Glycolysis / Gluconeogenesis
ccar00020  Citrate cycle (TCA cycle)
ccar00620  Pyruvate metabolism
ccar01100  Metabolic pathways
ccar01200  Carbon metabolism
Module
ccar_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109079646 (dlat)
   00020 Citrate cycle (TCA cycle)
    109079646 (dlat)
   00620 Pyruvate metabolism
    109079646 (dlat)
Enzymes [BR:ccar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     109079646 (dlat)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding DUF3597
Motif
Other DBs
NCBI-GeneID: 109079646
NCBI-ProteinID: XP_018950323
Position
Unknown
AA seq 408 aa AA seqDB search
MLRLALRVRPSVRFTRPSVLPGRAAAAASPRSGPVSCIHLKRYHSNGPARIRSLCHGRRV
YNIILSNRSWVLRSQMASFSQSMRVYSLPPHQKLEIAFCFEVQEEGYLAKIMIAEGTRDV
PLGTPLCIIVEKESDISTFADYVETGVAASPPPAPTPVAAPVPAPAPAAPTAAPTTAPAA
PRKGRVFASPLAKKLAAEKGIDIAQVTGTGPDGRVTRKDIDSFVPLKPTPAPAAAPAPAA
PTPSPPAAPAFAAVPTGTFTDIPISNIRRVIAQRLMQSKQTIPHYYLSIDVNMDQVLELR
KELNAEVKADNIKLSVNDFIIKASSLACLKVPEANSSWMDTVIRQNHVVDVSVAVSTPMG
LITPIVFNAHIKGLATISKDVAILAAKAREGKLQPHEFQYAQEPDVTR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgtttagcgctgcgagtgcgcccatctgtcaggtttacccggcccagtgtcctc
ccaggccgtgctgctgctgctgctagtccacgatccggaccggtatcatgcattcatctc
aaacgataccactccaacggcccggccaggatccggagcttgtgtcacggtcggcgagtg
tacaacatcatcctcagtaacagatcatgggtcctgcgaagccagatggctagtttcagt
caaagcatgagagtgtacagtctgcctccacatcagaagctggaaattgcattttgtttt
gaggtacaggaagagggttacctggccaagattatgattgctgagggcaccagggacgtt
cccctcggcactcccctctgcatcattgtggaaaaggaatccgacattagcacgtttgct
gactatgtagagacaggggttgctgcaagcccacctcctgctcccacaccggtggctgcc
ccagtgccagcaccagctccagcagctcccaccgcagcacctaccactgctccagctgct
cctaggaagggtagggtgtttgccagtcctctagccaagaaactggctgctgagaaggga
attgacatcgcccaagtcacaggaactggtccagatggcagagtcaccaggaaagatatc
gacagttttgttccacttaagcccactcctgcaccagctgctgctcctgcccctgctgcc
cccacacccagtcctccagctgcccctgcttttgctgctgtacctacaggaaccttcacc
gacatccccatcagcaacatccgcagagtgatcgcccagaggttgatgcagtcgaaacaa
actattcctcactattatttgtctatcgatgtcaacatggaccaagttcttgaactcagg
aaagaacttaatgctgaggtgaaagctgataacatcaaactctcggtcaatgacttcata
atcaaggcctcatctctggcgtgtttaaaggtgccagaggccaactcctcctggatggat
acagtcatcagacaaaatcatgtggtggatgttagtgttgcagtcagcacgcctatgggt
ctaattactcccattgtatttaatgctcatattaagggacttgcgactatcagcaaagac
gtagccatattagctgctaaagcacgagagggtaaactacagccacatgaattccagtac
gcgcaagaaccggacgtgacgcggtag

DBGET integrated database retrieval system