KEGG   Cyprinus carpio (common carp): 109080177Help
Entry
109080177         CDS       T05134                                 

Definition
(RefSeq) lysine-specific demethylase 2B-like isoform X1
  KO
K10276  F-box and leucine-rich repeat protein 10/11 [EC:1.14.11.27]
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ccar04121]
    109080177
   03036 Chromosome and associated proteins [BR:ccar03036]
    109080177
Enzymes [BR:ccar01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.27  [histone-H3]-lysine-36 demethylase
     109080177
Ubiquitin system [BR:ccar04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     109080177
Chromosome and associated proteins [BR:ccar03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    109080177
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: JHD Cupin_8 JmjC DUF1447 Cupin_1
Motif
Other DBs
NCBI-GeneID: 109080177
NCBI-ProteinID: XP_018950823
Position
Unknown
AA seq 575 aa AA seqDB search
MHSLVRRLLHRVEVVHVADRFDVGQDAGAHHEGEQVDGHQHSGASTESDQQSWGIVVIGV
QLYFHHGHLWNERKTQRSICRRMYDENEDLSDVEEITNIRGFSVEDKLESNSYNSEFVQF
MEGKDFTYEYVQREALRTPLVFKAKDGLGIRMPDPEFTVSEIKGLVGSRRAVDVMDVSTQ
KGSEMSMAQFVRYYETPEDERDKLLNVISLEFSHTKLENLIKRPTVVDLVDWVDNMWPRH
LKQKQTEATNVMSEMKYPKVQRYCLMSVKGCFTDFHIDFGGTSVWYHVFKGRKVFWLIPP
SPHNLSLYEDWVLSGKQSDIFLGDRSDGCQRVELKQGYTFFIPSGWIHAVYTPEDTLVFG
GNILHSFNIPMQLTVYEIENRTKVHSKFRYPFFYEMCWYVLERYVNCLTRRSHLSLDFRV
HAAEPKLVTESLVSAPRLDMEEDSCETRLERTEGTTQPSSTVPPYQTFKSPADDSEDSFK
SLPSECPKTPSGSPGMEHSGKWTHLTEFEINGLKALVEKLESLPETKKCVPEGIEDPQAL
LDDVKVVLKEHADDNPKLAITGSPIVCWPKKTGKV
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgcattctctcgtgaggagactccttcacagagttgaggttgtgcacgttgctgaccgc
ttcgatgttgggcaggatgcaggtgctcaccatgagggcgaacaggtggacggccaccaa
cacagtggtgcaagcactgaaagcgatcagcagtcctgggggatagtcgtgattggtgtc
cagctgtacttccaccatggccacctgtggaatgaaaggaaaacacagcgctcgatctgc
agaaggatgtacgatgagaacgaggacttgtcagatgtggaggaaatcacaaacatcagg
ggcttcagcgtggaggacaaacttgagagcaattcatacaacagcgaatttgttcagttt
atggagggaaaagattttacttatgaatatgttcagagagaggcactgcgaactccgctc
gtatttaaagccaaagatggactgggaattaggatgccggatccagaatttactgtaagt
gaaatcaagggtttggttggcagcaggcgggctgttgacgtgatggatgttagcacacag
aagggctcagagatgagcatggctcagtttgtccgctactatgagacgcctgaggatgaa
cgtgacaagctgctcaacgtcatcagcctggagttcagtcacaccaaactggagaatttg
atcaagagacccactgtggtggatctggtggattgggtggacaatatgtggccgcggcat
cttaaacagaaacaaaccgaagccacaaatgtcatgtctgagatgaaatatcccaaagtt
caaagatactgtctgatgagtgtaaaaggctgtttcactgacttccacatcgactttggc
ggcacatcagtatggtaccatgtcttcaaaggaagaaaggtcttctggctgattcctcca
agcccacacaatctgtctctgtatgaggactgggtgctgtcaggcaaacagagtgatatc
ttcctgggtgaccgttcagacggctgccagcgagtagagctgaaacagggctacacgttc
ttcatcccttcaggttggatccatgccgtctacactccagaagacaccctggtgtttggt
gggaatattttacacagttttaacattcccatgcaactcactgtctacgaaattgagaac
agaacaaaggtgcactccaaattccgctaccctttcttctatgagatgtgctggtatgtg
ttggagaggtacgtgaactgcttgaccagacgttcgcacctcagcctggacttccgcgtt
cacgctgctgaacccaagcttgtaactgagagtcttgtctctgctcctcggcttgacatg
gaggaggactcgtgtgagacacggttagagaggacagaggggacgacccagccctcctcc
actgtccctccctatcagacctttaaatccccggccgatgattctgaagacagcttcaag
tccctgccttcagagtgtcccaagactccgtctggctcgcctggaatggaacattccggc
aaatggacccacttgacagagtttgagataaatggactcaaggccttggtggagaagctg
gaatcccttccggagacaaagaaatgcgttccagagggcatcgaggatccacaagcactg
ctagatgatgtgaaggttgtgttaaaggaacatgcagatgacaatccaaagttggccatc
actggttctcctattgtatgctggccgaagaagacaggcaaggtatga

DBGET integrated database retrieval system