KEGG   Cyprinus carpio (common carp): 109081322Help
Entry
109081322         CDS       T05134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: ectonucleotide pyrophosphatase/phosphodiesterase family member 1-like
  KO
K01513  ectonucleotide pyrophosphatase/phosphodiesterase family member 1/3 [EC:3.1.4.1 3.6.1.9]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00230  Purine metabolism
ccar00240  Pyrimidine metabolism
ccar00500  Starch and sucrose metabolism
ccar00740  Riboflavin metabolism
ccar00760  Nicotinate and nicotinamide metabolism
ccar00770  Pantothenate and CoA biosynthesis
ccar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    109081322
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109081322
   00240 Pyrimidine metabolism
    109081322
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    109081322
   00760 Nicotinate and nicotinamide metabolism
    109081322
   00770 Pantothenate and CoA biosynthesis
    109081322
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ccar04090]
    109081322
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ccar00537]
    109081322
Enzymes [BR:ccar01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     109081322
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.9  nucleotide diphosphatase
     109081322
CD molecules [BR:ccar04090]
 Proteins
  109081322
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ccar00537]
 Enzymes
  109081322
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphodiest Somatomedin_B Sulfatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 109081322
NCBI-ProteinID: XP_018951851
Position
Unknown
AA seq 403 aa AA seqDB search
MDSARRDEHMSEHAANLLGTGQRSKRTQSATKTQSRYLKILCAVLLLGLLALILTIIFIL
KLRCSDKVTESCRNRCLSKSRDSNAVCHCDTGCVNVGTCCLDYKEVCVEPSQRWMCSKFR
CGEERLLNSLCSCSEDCVKVGDCCSNYKSICEGEKPWIEEDCEDIRTPQCPAGFSKPPLL
LVSLDGFRAGYMNAYSSLLPVISKLRKCGTSTPYMRPAYPTKTFPNHYTIVTGLYPESHG
IVDNKMYDVTRNASFSLKAVEKFNPAWYQGEPVWLTAMRNKLKTATFFWPGSDVKVNGQY
PDFWVKYDGNIPFEKRVAKIFEWLHLPEGERPDFYTLYFEEPDTAGHRYGPMSSQVIEAL
LNVDRVIGLLMEGLKQRQLHKCVNLVLVSDHGEYCVSFPHTLF
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggactcagccaggcgggatgaacacatgagcgagcacgccgccaacctactggggaca
ggacagcggtccaaacggacacaaagcgccacgaaaacacagtcaagatacttgaaaatc
ctctgtgcggtccttctgcttggcttgctggctttaattctcacaatcatatttatactc
aaactccgttgcagtgataaagttaccgagagctgtagaaatcgctgcttgtccaaaagt
cgtgactctaatgcagtgtgccactgtgacactgggtgtgtaaatgtaggcacctgctgt
ctggactacaaggaagtgtgtgtggaaccaagtcagcgctggatgtgttcgaaattccgc
tgcggtgaggagcgtttgctcaacagcctctgctcctgctctgaagactgtgtgaaagtg
ggtgactgctgctcaaactacaagagcatatgtgaaggtgaaaaaccttggattgaagaa
gattgtgaggacatcaggactcctcaatgtcctgctgggttttctaaaccgccgctgctt
ctggtgtctctggatggattcagggcaggatacatgaacgcctacagcagcctgcttcct
gtcatcagcaaactcaggaaatgtgggacctctacaccgtatatgcgacctgcttatccc
accaagaccttcccaaatcattacaccatagtgacaggtctatatccggaatcccatgga
attgtggacaataagatgtatgatgtcactcgcaatgcctctttcagtttgaaagctgtt
gagaaattcaaccctgcatggtaccagggtgaaccagtttggctcacagccatgagaaac
aaactaaaaacagctactttcttctggcctggatccgatgtgaaagtcaatggacaatac
ccagatttctgggtgaagtatgacgggaacattccctttgaaaagagggtggcaaaaatc
tttgaatggttgcatttacctgaaggagaaaggccagacttttacaccttatactttgaa
gagcccgataccgcgggtcatcgatatggaccaatgagtagccaggtcattgaggcctta
ctgaatgttgacagggttattgggttgctgatggagggtctcaaacaaagacagttgcac
aaatgtgttaacctggttctggtctctgaccacggtgagtactgtgtgtctttcccacac
acattattttaa

DBGET integrated database retrieval system