KEGG   Cyprinus carpio (common carp): 109081829Help
Entry
109081829         CDS       T05134                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II delta chain-like
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04012  ErbB signaling pathway
ccar04020  Calcium signaling pathway
ccar04114  Oocyte meiosis
ccar04217  Necroptosis
ccar04261  Adrenergic signaling in cardiomyocytes
ccar04310  Wnt signaling pathway
ccar04912  GnRH signaling pathway
ccar04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109081829
   04310 Wnt signaling pathway
    109081829
   04020 Calcium signaling pathway
    109081829
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109081829
   04217 Necroptosis
    109081829
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    109081829
   04916 Melanogenesis
    109081829
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109081829
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccar01001]
    109081829
Enzymes [BR:ccar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     109081829
Protein kinases [BR:ccar01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   109081829
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 109081829
NCBI-ProteinID: XP_018952335
Position
Unknown
AA seq 115 aa AA seqDB search
ILSIYYPKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKEP
YGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDVRFLTQIYSISYI
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
attctctcaatatattacccaaagccagagaatcttctcttggccagcaagctgaagggc
gcagcagtgaaactggctgattttgggctggctattgaggtgcagggagaccaacaagca
tggtttgggtttgctggaactccgggttatctttctcctgaggtgctcagaaaggagcct
tatggcaaaccagtggacatgtgggcgtgtggtgttattctgtacatccttcttgtgggt
taccctcctttctgggatgaagaccaacatcgactttaccagcagatcaaagctggtgca
tatgatgtaagatttcttacacagatatatagtatatcgtatatatag

DBGET integrated database retrieval system