KEGG   Cyprinus carpio (common carp): 109082144
Entry
109082144         CDS       T05134                                 

Definition
(RefSeq) aryl hydrocarbon receptor-like
  KO
K09093  aryl hydrocarbon receptor
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccar03000]
    109082144
Transcription factors [BR:ccar03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    109082144
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 PAS_9
Other DBs
NCBI-GeneID: 109082144
NCBI-ProteinID: XP_018952601
Position
Unknown
AA seq 884 aa
MLRHLLERLPHMTDNGIALKNYSSNGLSANNSNHDNIKATGLVDGWLHEGELLLQALNGF
VLVVTAEGIIFYCSHTIQDYLGFNQTDVMHQNVFELIHTEDQQAFRRNLHWALNPPPTSM
QSEESPQDGDPAPSMSLVTCNPDQLPPENSSFLERNFVCRFRCLLDNSSGFLALNLQGRL
KFLHGQNRRLDDGGQMPPQLALFAIATPLQPPSIMEIRTKNMIFRTKHKLDFTPMACDAK
GKIVLGYTEAELRVRGSGYQFIHAADMLYCAENHVRMIKTGESGLTVFRLLTKDNRWKWV
QANARLVYKNGKPDYIIATQRPLVEEEGGEHLRKRSMHLPFTFATGEALLYQISYPMPGF
PDTLQGKSKNNKTKKSKADKSSKDDLDPSSLLGAMMRQDESVYVCQPAIEPRMSFHSSLF
SEQVETNTFSSSVENESWNPVQNGVTAVSKQEPSSFDPLLATLDSLSLENEESCSNSELF
SALENLGLNAEDLELLLLDERMIQVEMEADYIPSLNDLLTNNEILSYVQDSLENRIEDSM
DAQNSAVTLDSVEPPEPCSAFESTSQITSSMPDPHVPFWPQKQITPIVHLSQRMQQHLNG
QSVCHKTESWIQAPIPQVSTTDSETTTFTQHDTLLVNPVQAVHNGHWVPEHSQANLNSQL
CDKITGTSKAQSPQWQHNQLLDQFQYKQKTAVGIDTPPNGVYNDPQWHGYNFTDQLVTNG
PCFPNGQMAQTQTVGTHVDYNITDNSGVEFMMNISTAGDVGQFQGAMASSSSYHQGYQKQ
QQQPKVAPTFYASYTKQKSSLEHILGLAPPSNLPSLTDYSSELTHDATHSKMETGFILNS
ASVSYTGSCLVPNGNAVATPGNSPHPLSEPLPPPPDPQTTGFYL
NT seq 2655 nt   +upstreamnt  +downstreamnt
atgctgcgtcatctgctggaacggcttccgcatatgacagataacggaatcgctctgaaa
aactacagctccaatggtttgtcagcaaacaacagtaatcatgacaacattaaagcaaca
ggattggttgacggctggctgcatgagggagagctcctactacaggctctcaatggcttt
gtgttggtggtcaccgctgaagggatcattttctactgttctcacaccatccaggattac
ttaggattcaaccagacagatgtgatgcatcaaaatgtgttcgaactcattcatactgaa
gaccagcaggccttcagacgcaacttgcactgggccttgaacccgcctccaaccagcatg
cagtcagaagaatccccacaagatggagatcctgccccaagtatgtcgctggtgacgtgc
aaccctgaccagctgcctcctgaaaactcctctttcctggagagaaattttgtttgtcgt
ttccgatgcctcctagacaattcttcaggattcctggccctaaatcttcaaggacgtctg
aaattcctgcatgggcagaacaggcgattggatgacggaggccaaatgccgccccagctc
gccctgtttgccatagcgacacccctacagcctccttccataatggagatccgaaccaag
aacatgattttcagaaccaaacacaagttggacttcaccccaatggcctgtgatgctaag
ggtaaaatcgttcttggctacaccgaggcagagttgcgagttcgaggttctgggtaccag
ttcatccatgcagctgatatgctgtattgtgctgagaaccatgtcaggatgatcaaaaca
ggagaaagcggcctgactgtgtttagactgcttacaaaggacaaccgctggaaatgggta
caagctaatgctagactcgtctacaaaaatggcaaacctgactacatcattgccacccag
aggccgcttgtagaagaagagggcggagagcatttgaggaagcgatctatgcatcttcca
ttcacctttgctactggagaagctctgctgtaccaaatcagctaccccatgccaggcttc
cctgacacccttcagggcaaaagcaagaacaacaaaaccaaaaagagcaaggcggacaaa
agttcgaaggatgatctggacccaagttctctgctgggagccatgatgagacaagatgag
tctgtttatgtttgccagcctgctattgagcctagaatgtcattccacagtagcctcttc
agtgagcaagtagagactaataccttctcttcttctgtggaaaatgaaagttggaatcca
gtgcagaatggtgtaactgcagtctccaaacaggagccatcaagttttgacccactactg
gcaacattagactctctgtccctggaaaatgaggaaagctgctccaacagtgagctattc
agtgccctggaaaaccttggactcaatgcagaggacctagaattgctgcttctggatgag
aggatgatccaggtagagatggaagcagattacatcccatctctgaacgatcttctcacc
aacaacgaaatcctttcctacgtccaagactcactggagaaccggatcgaggactcgatg
gatgctcaaaactctgccgtgacattagattctgttgaaccccctgagccatgttctgct
ttcgagtcaacttctcagattacttcctccatgcctgatccccatgtacctttctggcca
caaaaacagataacacccatagttcatctctcacagcgtatgcagcaacatctcaatggc
cagtcagtttgccacaaaactgagagctggatccaggcaccaatacctcaggtgtccaca
acagactctgagacaactacatttacccagcatgatactttgttggtaaacccagtacaa
gctgtgcacaatggccactgggtccctgaacactcacaagcaaacttgaactctcaactt
tgtgacaagataacaggaactagtaaagcacaatcaccgcaatggcagcacaaccagttg
cttgaccaattccagtataaacaaaaaacagctgtgggtattgatacccctccaaatggg
gtctacaatgatccccagtggcatggatacaacttcacagaccagttggtcacaaatgga
ccatgttttcccaatggccagatggcgcagacacaaacagtgggtacacatgttgattac
aatataaccgacaattcaggggtggagtttatgatgaacatcagtacagctggggatgta
gggcagtttcagggagctatggcctcgtcctcgtcctatcatcagggttatcagaaacag
cagcagcagccaaaggtcgcacccactttttacgcctcctataccaaacagaaatcctct
ctggagcatatcctgggattagccccaccttcaaaccttccttcattgacagattatagc
tcggaactgacccatgacgccacccacagtaagatggagactggctttatactcaactct
gctagtgtgtcctacacaggaagttgtttggtccccaacggcaatgcagtggccacacct
ggcaacagtccccaccccctttctgagccactcccacctcccccagaccctcagaccact
ggtttctacctctga

DBGET integrated database retrieval system