KEGG   Cyprinus carpio (common carp): 109082792Help
Entry
109082792         CDS       T05134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: vacuolar protein sorting-associated protein 18 homolog
  KO
K20181  vacuolar protein sorting-associated protein 18
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109082792
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccar04131]
    109082792
Membrane trafficking [BR:ccar04131]
 Endosome - Lysosome transport
  Tethering complex
   CORVET complex
    109082792
   Hops complex
    109082792
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pep3_Vps18 Clathrin Vps39_2 Zn_ribbon_17 zf-C3HC4_2 zf-RING_11 zf-RING_2 zf-RING_5 DUF2229 zf-RING_UBOX zf-ANAPC11 zf-rbx1 DUF1664 zf-C4H2 DUF2175 zf-C3H2C3 DUF5600 KNOX2 DUF4446 PI3K_P85_iSH2
Motif
Other DBs
NCBI-GeneID: 109082792
NCBI-ProteinID: XP_018953173
Position
Unknown
AA seq 974 aa AA seqDB search
MASILDQYEDSQNIRQHSRVSAANIGITHSGFVNVRLEEEKPXFNKQRIDFSPPEKINHF
SVCNNQLCMSLGKDTLLRIDLGKPDQPNQIELGRKDDSKVHKLFLDPTGSHLVISLTTNE
CVYLNRNTQKVRSLSRWRGHLIESIGWNKLTGSETNTGPILVGTSQGIIFEAEISASEGT
LFNTNPDQYFRQVHSLEEDGKPAPVCCLEVERGLESKYFIVATTRKRLFQFVGKLAEGSE
QQGFSSIFAQNQDLLPSFQEFPVNMGYSEITFYTSKLRSSPKTFAWMMGNGVLYGQLDYV
RPDSLLSDVQVWEYTSDIDLNFVKPISIVLTQFHFLLLLPDRVKGICTLNGQVVHEDVFP
EKFGSLKKMIKDPITGLVWIYTEKAVFRYHIQREARDVWQMYMSMNKFDLAKEYCKDRPE
CLDMVLAKEAEHCFQNKRYLESAKCYALTQNYFEEIALRFIEAKQEEALKEFLIKKLTNF
KPTEKTQITLLVTWLTELYLNRLGQLETDDGKQHLFLETREEFRTFLKSPKHKECFYNNR
NTIYDLLASHGDVDNMVYFSVIMQDYERVISHYCQHDDYSAALDVLSKHCDDKLFYKFSP
VLMQHIPKKVVDAWIQMGNRLDPKNLIPALVNYSQMGSMQLDKETIRYMEFCVYELDVKD
EAIHNYLLSLYAKHKPDSLLWYLEQAGTHVSDIHYDLKYALRLCAEHGYLQACVLVYKIM
ELYEEAVDLALQVDVDLAKSCADLPEDDEELRKKLWLKIARHVVQEEKDVKKAMNCLSSC
NLLKIEDILPFFPDFVTIDHFKEAICNSLEEYNQHIEELKQEMEEATESAKRIREDIQEM
RNKYGVVESQEKCATCDFPLLNRPFYLFLCGHMFHYDCLLQEVIPHLSSYKQNKLDELQK
KLAATTQTTKSRHRPKEEDTVSLGKGQGSREQIKSDIDDIIACECVYCGELMIKSIDKPF
IEPQKFDQEMSSWL
NT seq 2925 nt NT seq  +upstreamnt  +downstreamnt
atggcatctattctggatcaatatgaagattctcagaacatccgtcagcacagccgagtg
tcagcggctaacatcgggattactcattcagggtttgtgaatgtaaggttggaggaagag
aaaccanttttcaacaagcagcgcatcgatttctcacctcccgaaaaaatcaaccatttc
tcagtgtgcaacaaccagttatgcatgagtctggggaaggacaccctgctgagaattgat
cttggaaaacctgatcagccaaatcagattgaactgggaagaaaggatgatagcaaagtg
cacaaacttttcctagatcctacagggtcacatttagtcatcagcctgaccacaaacgaa
tgtgtatacctaaaccgaaacactcaaaaggtccggagtctgtcacgatggagaggtcac
ctgattgaaagcataggatggaacaaattaaccggctctgagaccaacaccgggccgatt
ctggtcggcaccagccagggaatcatctttgaagcggagatatctgcctcagagggcact
ctgtttaacactaacccagaccagtacttcagacaggttcattctttggaggaggatggc
aagccagctccggtttgttgcctcgaggtggaacgtggcttggaatccaagtacttcatt
gttgcgaccacacggaaacgccttttccagtttgtaggaaagctggcagagggatccgag
cagcaggggttcagctccatctttgcccagaaccaggatctcctacccagcttccaggag
tttccagtcaatatgggctacagtgagattacgttctacacgtcaaagctgcgcagttcc
ccgaagacctttgcatggatgatgggaaatggggttttgtatggacagctagactacgtg
cggcccgactctctactcagtgatgttcaagtgtgggaatacacatcagacattgatcta
aacttcgtcaagcccatctctatagtactcacacagtttcacttcctgctcctgctccca
gatcgcgtcaagggtatctgcactctgaacgggcaggtagtgcacgaagatgtgtttcca
gaaaagttcggcagtctaaaaaagatgatcaaagatcccatcaccgggctcgtgtggatc
tacacagagaaagctgtgtttcgctaccacatccagagggaggcgcgggacgtttggcag
atgtacatgagcatgaataagtttgacctggccaaagagtactgcaaagaccgaccagaa
tgcctagatatggtgcttgccaaagaggcggagcactgcttccagaacaagcgctacctg
gagagcgccaaatgctacgctctcactcagaattactttgaggagattgcgctgaggttc
atcgaggccaagcaggaggaggccttgaaagagtttctgattaagaagctgaccaacttc
aagcccaccgagaagactcagatcaccctgctggtcacctggctgacagaactctatctg
aaccggctcggtcaactggagaccgatgacggcaaacaacacctcttcctagagacccgc
gaagagttccgcacctttcttaaaagccccaaacacaaagagtgcttctacaacaatcgc
aacaccatctacgacctgctcgctagtcacggcgacgtggacaacatggtgtatttctcg
gtcatcatgcaagattatgaacgcgttatatctcattactgccagcatgatgactacagt
gcagctttagacgttctctccaaacactgcgatgacaagctcttctacaagttctcccca
gttctcatgcagcacatccccaaaaaggtggtcgatgcatggattcagatgggaaatcgg
ttggatcccaagaatctgatcccagcgctggtgaactacagccagatgggcagcatgcag
ctagataaagagaccatccggtacatggagttctgtgtgtatgagctggatgtcaaagac
gaagccattcacaattacttactctcgctttatgccaaacacaagccggattctctgttg
tggtacctcgaacaagcgggaacacatgtctctgatatccactatgacttgaaatatgcc
ttacgcctttgtgccgagcatgggtacctgcaggcctgcgtcttggtttacaagattatg
gagctgtatgaggaagctgtggatctagctctacaggtggatgtagatttggccaagtct
tgcgccgaccttccagaggatgacgaggagttgaggaagaagctgtggctgaagattgct
cgtcatgtggttcaggaggagaaggatgtcaagaaagccatgaactgtctttccagttgc
aaccttcttaagattgaggacatcttgcctttctttccagattttgttacgatagaccac
ttcaaggaggcaatttgcaactccctggaagagtacaaccaacacatcgaggagctgaaa
caagaaatggaggaggccacagaaagtgccaaacgtatccgtgaagacatccaggagatg
aggaacaagtatggggtggtggagtctcaggaaaaatgtgccacttgtgatttccccttg
ctcaaccgacctttctatctcttcctttgtgggcacatgttccattatgattgcctctta
caggaagtcatccctcacctctcttcctataagcagaataaattagatgagctacagaag
aagctggcagcgaccacgcagaccaccaaatccaggcacaggcccaaagaggaggatacg
gtcagcttaggcaagggtcaaggaagcagagagcagatcaagtcagacattgatgacatc
atagcgtgtgagtgtgtctactgtggagagctaatgatcaaatccattgacaagcctttc
atagaaccacagaagtttgatcaagagatgtccagctggctctga

DBGET integrated database retrieval system