KEGG   Cyprinus carpio (common carp): 109083864Help
Entry
109083864         CDS       T05134                                 

Definition
(RefSeq) ras association domain-containing protein 5-like
  KO
K08015  Ras association domain-containing protein 5
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    109083864
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RA Nore1-SARAH SPESP1 Ras_bdg_2
Motif
Other DBs
NCBI-GeneID: 109083864
NCBI-ProteinID: XP_018954143
Position
Unknown
AA seq 364 aa AA seqDB search
MSIQHSHTFSAIYSKTVSRGFKEPSCWLNSAGEAASVQLPVCDLWKQELCIRYRLQRSLS
VILQVSALFPAARGALALHLNLWSPAPSPSSPSQPWSLEWCVWSPKDPRRESLKLDPSPQ
MTGSNSTSSGYGAWDEDKQVPKSVTREEDKEEEKPTSLTKEDIKAKIDDYNSKVTENGMK
LSSDGTYTGFIKVHLKLRRPVTVDSGDGKSPGPGSSSDSSDNRTSFYLPRDAVKQLHISS
TTTVGEVIQGLLKKFMVQDNPRKFALYRLTRRDSQDLFQKLPLSECPLCLRLLAGPDLES
LSFVLKENETGEVEWHAFSVPELQNFLIILEKEEKERMRQVELRYAAYREKLLLALGQVE
SKPG
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgtctatccagcattctcacaccttcagcgccatttacagcaagactgtcagtcgtggg
tttaaagaaccaagctgttggctgaatagtgcgggagaagctgcttctgttcagctgcct
gtttgtgacctgtggaaacaggaactgtgcatcagataccggctgcaacgctcgctgagc
gtcatcctgcaagtttcggcactttttccggcggcacgtggagctctggcccttcacctg
aacctgtggtcccctgctcccagcccatcctccccttcccaaccctggagcctggaatgg
tgtgtttggtcccccaaagacccgcgtagggagtccctcaaactggatccatccccacaa
atgaccggtagcaatagcacgagcagtgggtacggagcctgggatgaggataagcaagta
cctaagagtgtcacaagagaggaagataaagaggaagagaagccaacatccctcacaaaa
gaagatattaaagctaaaatagatgactacaactccaaagtgacagagaatggaatgaaa
ttaagctcagatggcacatacactggtttcataaaggttcacttgaagttgcgcaggccc
gtgactgtagattctggggacgggaagtcgccaggaccgggttcctcttctgatagttca
gataaccgcacatccttttacttgccaagagatgccgttaaacagctacacattagcagt
accaccacggtcggggaggtcattcagggcctgctgaagaagttcatggtacaggataac
ccacgcaagtttgccctctaccgcctgacccgtcgagacagccaggatcttttccagaag
ttgccgttatcagaatgcccactctgcttgaggctgttagcaggtcctgatctagagagc
ttgtcttttgtactcaaagaaaatgagactggcgaggtggagtggcatgcattttcagtc
cccgagctgcagaacttcctgatcatcctggagaaggaggagaaggagcgcatgcggcag
gtggagctgcgttacgctgcctacagggagaagttgctactggctctgggtcaagttgag
agcaaaccaggctaa

DBGET integrated database retrieval system