KEGG   Cyprinus carpio (common carp): 109083982Help
Entry
109083982         CDS       T05134                                 

Definition
(RefSeq) UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like
  KO
K01001  UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase [EC:2.7.8.15]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00510  N-Glycan biosynthesis
ccar01100  Metabolic pathways
Module
ccar_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    109083982
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ccar01003]
    109083982
Enzymes [BR:ccar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.15  UDP-N-acetylglucosamine---dolichyl-phosphate N-acetylglucosaminephosphotransferase
     109083982
Glycosyltransferases [BR:ccar01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   109083982
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_4 DUF4133
Motif
Other DBs
NCBI-GeneID: 109083982
NCBI-ProteinID: XP_018954255
Position
9
AA seq 406 aa AA seqDB search
MSPIPALPLIINCCMSALGCIATVKLIPAFKDHFISARLYGMDLNKTIKKEVPESQGVIS
GTVFLIILFLFIPVPFLHCFMGERCQRFPHNEFVQLIGALLAICCMIFLGFADDVLNLRW
RHKLMLPTIASLPLLMVYFTNFGNTVIVVPKPFRVLLGMHLDLGILYYVYMGMLAVFCTN
AINILAGINGIESGQALFISGSIILFNLLELNGDYRDDHVFSLFFMIPFFFTTLALFYHN
WYPSSVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVINFIYSLPQLFHIIPCPRH
RLPRLQSDTGKLGMSYSKFKQKDLGKLGRLILEVAEMLWLLDVRRGQEGDDEFIECNNMT
LINLVLKVLGPTHERNLTAIMLLIQVLGSAVAFGIRYHLVRLFYDV
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgtctccaattcctgctcttcctcttatcattaactgttgtatgtctgcacttggctgc
attgcaactgtcaagcttattcctgcttttaaggatcatttcatatctgcaagactctat
ggcatggacctaaataaaaccataaagaaagaggtgcctgaatcgcaaggtgtaatcagt
ggcacagtcttcctcatcattctcttcctcttcatccctgtgcccttcctccattgcttc
atgggagagcggtgtcaacggttccctcacaacgagtttgtgcaactgattggtgctttg
ttggccatctgctgcatgatattcctgggctttgctgatgatgttctgaacctacgatgg
agacacaagctaatgctgcccactatagcctccctgcctctactcatggtctacttcact
aactttggcaacactgtcatcgtcgtgcccaaacctttccgtgtcctgctggggatgcat
ctggacttgggcattctgtattatgtatatatgggaatgttggctgtgttctgcacaaat
gccattaacatcttggctggtatcaatggcattgagtcagggcaagctctcttcatatct
ggctccatcatcctctttaatttactggagctcaatggagactacagggatgatcatgtt
ttctctttgttcttcatgattccctttttcttcaccacattagccctcttctaccacaac
tggtatccttcctctgtgtttgtgggagacactttctgttactttgctggaatgacgttt
gcagtggttgggatactcggccacttcagtaagaccatgctgcttttcttcatcccccaa
gtcatcaacttcatttactctctgcctcagctgtttcacattatcccctgtccaagacat
cgcctgcctaggttacagtctgacacaggaaagcttggcatgagctactccaaattcaaa
cagaaggacctgggcaaattaggacgacttattctggaggtggcagaaatgttatggctc
ctggatgtgcgtagagggcaggaaggagatgatgagtttattgagtgtaacaacatgact
cttatcaacctggtactaaaagtgctgggacctacccatgagagaaacctgactgcaatc
atgctgttaatacaggtcttggggagtgccgtggcgtttggaatccggtatcatcttgtg
cgtctgttctacgacgtctag

DBGET integrated database retrieval system