KEGG   Cyprinus carpio (common carp): 109085468Help
Entry
109085468         CDS       T05134                                 

Definition
(RefSeq) serine/threonine-protein kinase WNK3-like
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccar01001]
    109085468
   01009 Protein phosphatases and associated proteins [BR:ccar01009]
    109085468
Enzymes [BR:ccar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109085468
Protein kinases [BR:ccar01001]
 Serine/threonine kinases: Other
  Wnk family
   109085468
Protein phosphatases and associated proteins [BR:ccar01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109085468
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 109085468
NCBI-ProteinID: XP_018955562
Position
Unknown
AA seq 262 aa AA seqDB search
MENLTGSNSEQQPVGFTVPSVPSKKTVIYENGHEHPTHTNSAAAAHRGASDPTAYPLSDF
KSLVRQRFIRRSLWFSESEDQEFEVSECDTTSSPVKSARIAVQRSFNADSQVGQRDDVNE
NFPKEPETIEAEKKHDAEPSETPKSVGKSGSDENEEEAEMKAVSTSPGGRFLKFDIELGR
GSFKTVYKGLDTETWVEVAWCELQDRKLSKAERQRFKEEAEMLKGLQHPNIVRFYDFWES
PLKGKKCIVLVTELMTSGTLKT
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacttgactggatccaactctgagcagcagcctgtgggcttcacagttccttct
gtcccctcaaaaaagactgtaatttatgaaaatggtcatgaacatcccactcacacaaac
tccgcagctgcagcacacagaggggccagcgatccaactgcataccccctatcagatttc
aaaagtctggtccggcagagatttatacgcagaagtttgtggttctctgagtcagaggat
caagaatttgaggtttcagagtgtgacaccaccagcagtcctgttaaaagtgcacgtatt
gcggtccagaggagctttaacgcagatagtcaggtgggacagagggacgatgtaaatgag
aacttccccaaagagccagagacaattgaggctgagaagaaacatgatgctgaaccatct
gaaacgcccaagagtgtggggaaatctgggagtgacgagaacgaggaagaggccgaaatg
aaggccgtatccacctcgccaggtggacgctttcttaagtttgatattgaacttggcaga
gggtccttcaaaacggtctataagggcctggacactgagacgtgggtggaggtggcctgg
tgtgaacttcaggatcgtaagctgtccaaagcagaacgtcagaggtttaaagaggaggca
gagatgctgaaaggtcttcagcatccaaacattgtgcgcttctacgacttttgggaatct
cctcttaagggaaagaagtgcattgttttagttactgaactgatgacgtctgggacactg
aaaacgtga

DBGET integrated database retrieval system