KEGG   Cyprinus carpio (common carp): 109085768
Entry
109085768         CDS       T05134                                 

Gene name
apln
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04080  Neuroactive ligand-receptor interaction
ccar04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109085768 (apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109085768 (apln)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 109085768
NCBI-ProteinID: XP_018955808
Position
Unknown
AA seq 77 aa
MNVKILTLVIVLVVSLLCSASAGPMASTEHSKELEEVGSMRTPLRQNPARAGRSQRPSGW
RRRRPRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatgtgaagatcttgacgctggtgattgtcctggtggtttctctgctgtgttcagcc
agtgctggtccaatggcctccaccgagcatagcaaagagctagaggaggtgggcagcatg
aggactcctttgcggcagaatcccgctcgagccggccggagccaaagaccttctggctgg
aggaggagacgccctcgaccccgcctctcccataaggggcccatgccattttag

DBGET integrated database retrieval system