KEGG   Cyprinus carpio (common carp): 109087689
Entry
109087689         CDS       T05134                                 

Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator-like
  KO
K09097  aryl hydrocarbon receptor nuclear translocator
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccar03000]
    109087689
Transcription factors [BR:ccar03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    109087689
SSDB
Motif
Pfam: HLH PAS PAS_3 PAS_11
Other DBs
NCBI-GeneID: 109087689
NCBI-ProteinID: XP_018957437
Position
Unknown
AA seq 741 aa
MTSANSDMPEVPSLATAAGSLSNSAAVVPKANNKRQATSDYDDDEGSKLFRCDDDGGGSN
DKERFARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMKSLRG
SGSSSTDGAYKPSFLTDQELKHLVLEVADGFLFVVSCETGRVVYVSDSVTPVLNQAQSDW
LGSSLYDQLHPDDTEKLREQLSTSENNNAGRMLDMKTGTVKKEGGQASVRMSMGTRRSFI
CRMRCGVCPVEPVSMNRLHFLRSRNRNGLGPPKEGEPQYAVVHCTGFIKSWPPAGVTLSE
EEADNNQGNRFCLVAIGRLQVTCCPSDTNINSISVPVEFISRHSCQGLYTFVDHRCQATV
GFQPQVGLRNLSQGHFCRVVKLRGQVLSVMFRFRSKSREWIWMRTSSFTFQNPFSEEIEY
IICTNANVNRGANQDPLSPLSSPGVSLPPSLGQSSPNCPSTPSPGQVTARQMQQQAELDG
GMGRDAAYESNQATLPQVPVQTVGVVAADHNSKTVCSSASGGQQVYPPAASFPSSARPGE
PFRSAGMAQQMVPHSAGQMLAQMSLQSTPSGVSGSNNSPIQTQTGPAAPPGVWSATRPPF
NTQQMAGQVGKSQSPQFNMGGFSSAPTSSTSSSFGQMGGASASMANTSNYQQINSHINPS
TNGFGDINQMGAQFSSRPAEGVSGWQQWQTQPHTQGTADTHQQPPNSQPEMFQDVISMLD
QTGSFGSDDFAEMPMFPPFPE
NT seq 2226 nt   +upstreamnt  +downstreamnt
atgacatcagccaattcagatatgcccgaggtgccttcgctggccacagcagctggatct
ctctctaacagtgccgccgttgtgccgaaggccaacaacaagagacaagccacctcggac
tatgacgacgacgagggaagcaaattgttcaggtgtgatgatgacggaggcggatccaat
gacaaggagagatttgccagggagaatcacagcgagatcgagcgcaggcggaggaataag
atgaccgcgtacatcaccgagctgtcagacatggtgcccacctgcagcgctctggcacgc
aaaccagacaagctcaccatcctgcgcatggctgtgtcacacatgaagtctctccgagga
agcggcagcagcagcaccgatggagcatataaaccctccttcctcacagaccaggagctg
aagcacctggttctggaggtggctgatggttttctgttcgtggtgtcgtgtgagaccggc
cgtgtggtttacgtgtcggactcggtcacaccggttctgaaccaggctcagtcggattgg
ctgggatcatctctgtatgaccagctccatccagacgacacagagaaactccgagagcag
ctctccaccagcgagaacaacaacgccggccggatgttggacatgaagacaggcacggtg
aagaaagagggagggcaagcctctgtgaggatgagtatgggcacacgccgctccttcatc
tgcaggatgagatgtggagtgtgtcccgtagagccggtgtccatgaacagactccacttc
ctgagaagcagaaacaggaatggactgggtcctcctaaggagggtgagccgcagtacgcg
gtcgtgcactgcacaggcttcatcaagtcctggcctcctgcaggagtgactctttctgaa
gaggaggccgataataatcagggaaatcgtttctgtctagtcgccattggaaggcttcag
gtcacatgttgcccgagcgacacaaacataaacagcatcagtgttccggtggaatttatt
tcccgccacagctgtcagggcctctacaccttcgtggatcaccgctgtcaggccacggtg
ggcttccagcctcaggtaggcctcagaaacctgagtcagggtcatttctgcagagtggtg
aaactgcgaggtcaggtgctctcggtgatgttccggttccgctctaaatcccgcgagtgg
atctggatgagaacgagctcgttcaccttccagaaccctttctctgaagagatcgagtac
atcatctgcaccaacgccaatgtcaatagaggtgcgaatcaggaccccctgtcccccctc
tcttccccgggggtctcactgcccccctcactggggcagagcagtccgaactgcccctcc
acccccagcccagggcaggtcacagccaggcagatgcagcagcaggccgagttagacgga
gggatgggacgagacgcagcgtatgaatccaaccaggccactcttcctcaggttccagtg
cagactgtaggtgtggtcgctgctgatcacaactctaagaccgtgtgctccagtgcctcc
ggtggacagcaggtttacccaccagcagcgtctttccccagctctgcacgtcccggcgag
cccttcaggtcagctggaatggcccagcagatggttcctcactcagcgggtcagatgctg
gcgcagatgtcccttcagagcacaccgtctggagtcagcggcagcaacaacagccccatt
cagacccagacgggacccgcagcgcctcctggagtctggtctgccacacgaccgcccttc
aacacacagcagatggcaggtcaagttgggaagagtcagtctcctcagtttaacatggga
gggttcagctccgcccctacatcctccacttcctcttcctttggccagatgggcggggct
tctgcttcaatggccaacacatcaaattaccaacaaataaacagtcacatcaacccatca
actaatggattcggtgacattaatcagatgggagcgcagttcagctccaggccagcagag
ggagtgtcaggctggcagcagtggcaaactcagccacacacacaaggcactgcagacaca
caccagcagcctccaaacagccagccagagatgtttcaggatgtgatctccatgttggat
caaaccggcagcttcggcagcgatgattttgccgagatgcccatgtttcctcctttcccc
gagtag

DBGET integrated database retrieval system