KEGG   Cyprinus carpio (common carp): 109087872
Entry
109087872         CDS       T05134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: A disintegrin and metalloproteinase with thrombospondin motifs 13-like
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ccar01002]
    109087872
Enzymes [BR:ccar01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     109087872
Peptidases and inhibitors [BR:ccar01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   109087872
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 TSP1_CCN TSP1_spondin ADAM_spacer1
Other DBs
NCBI-GeneID: 109087872
NCBI-ProteinID: XP_018957606
Position
Unknown
AA seq 1160 aa
VDCLCSAGKAECVKDVPVLGGSVQDWRPGLFYGVDDQCRIAFGSSATACSFTNGDMATCR
VLSCHINPRDRSSCTRLLVPLLDGTECGPSQWCLKGRCVSPSSLGSSIMVHGSWSSWSEF
SPCSRTCGGGITYRRRQCNNPRPAFGGTVCKGQDTEAELCNRQSCESTQLEFMSQQCSAT
DQKLLSVSPDSSSVYTWIPAVGYSSGDAQCKLMCRSREQDFMVSRGSQFIDGTRCEAAHT
APRGSISACLGGKCQLFGCDGVMHSGKVADVCGVCGGNGSTCKFISNTYSGGEAGEYVTF
LSLPLNASQVHVINTKPVFTHLAVLLNDKYVVSGDGSPGLSITYPSPLEKSPLIYNLYLT
PDHLPQTEELTISGPVTDKIHIQVFRKYGQEYGDLTTPNISYQYYSSEAVSAERAAKGRW
STVISVCSVTCGTGIQKISQHCVDVLTLERLEDELCRSSPQAPDQLQPCFQTDCPPSWEV
GEFGPCSAPCGVGEQGRSVTCVQKQGTVKVELPDSDCALDSKPQTTETCNPQICPARWQV
SEPGECSAVCGPGEAQRTVSCVRSHHGSDSEVDQNLCSEPKPTERVPCVVDVCPVGWDSQ
REQIHTDSHVMPRSRMLPVYVWSPVIGQCSKTCGNGSQQVWFSCVDHQSRLEVPEFLCDR
TSKPEMYTQPCSPSKCPATWRYMQGPCSASCGGGVAKRVLYCSQRMEGADRNRDLVVGES
ACQSVTRPSEVVECNTEACPARWQAGQQGDCSVSCGMGVAVRSVRCVQYEGGIERVVEED
RCDPGIKPPITAPCFTQVCSFHWDVHEWSECSVSCGDGIQSRTVSCIGPSRPLPVSPFLC
LHLPKPITIQACYSPDCSSALDLHTRPNSTHIQSEPRREEGTQRTTPAPAVRMTKMRKSF
SATAAPADVMNSTISMTTEPPQTSVCGRLLLQDSGTIDLRNVTQMRCIFAIGRPLDEVIQ
IKILSSTLNCRQKENIALYDRLILMRLCERMSGKTLKSRSNVLLVRQSRLAPGNGVLLYY
QSVKNKKSHHGECDVQLFSPSGLIENPIKSAATAASNTQSCRVFIDAPPAFRIQIRASFC
AFRIQIRALSVLNNTDTNFTYILIRDVDALKTTIFRGTQLFLWSSSGSRAEVEFHGEYQQ
IKGTFRAEYSYINPSEEQPV
NT seq 3483 nt   +upstreamnt  +downstreamnt
gttgactgtctgtgcagtgctgggaaggcggagtgtgtgaaggatgtgccggtgctgggt
ggatcagtgcaggactggaggcctggtctcttctatggagtggacgatcagtgtcgtata
gcgtttggcagctcggctactgcttgctctttcactaatggtgacatggcaacctgtcgt
gttttgtcctgccatatcaaccctcgtgaccgcagctcatgcactcgtctcctcgttcca
ctcttggacgggacggagtgtgggcccagtcagtggtgtttgaagggccggtgtgtgtct
ccttcttctttgggttcctccataatggttcatggctcttggtcttcatggtctgaattc
tctccctgctcacgtacatgtggaggaggaatcacttaccgaaggagacagtgcaacaac
cccaggccagcctttggtgggaccgtctgtaaaggacaggacacagaagctgaactttgt
aatcggcagtcctgtgagtcgactcagctggagttcatgtctcagcagtgctcagccaca
gaccagaagcttctgtcagtgtctccagactccagctcagtctacacctggatccctgct
gtcggctacagctcaggtgatgctcagtgtaaactgatgtgtcgctcacgtgagcaggac
ttcatggttagtcgtgggtctcagttcatcgatgggacgcggtgtgaagctgcacatact
gcaccacgtggttccatttctgcctgtctgggtggaaagtgccagctttttgggtgtgat
ggagtaatgcattctgggaaggttgcggatgtgtgtggggtgtgtgggggcaatggctcc
acctgtaagttcatctcaaacacctattcaggcggagaggctggagagtatgtcacattc
ctcagccttcctctgaacgcctctcaggttcatgtgattaacaccaagccagtttttaca
caccttgcggtgttattaaatgataaatatgtggtgtctggagatggaagcccaggcctg
agcatcacatacccctcacctctggagaaaagccccttaatctataacctgtacctcaca
cctgaccacctgcctcaaactgaagagctcactatctctggaccagtcacagacaaaatc
cacatacaggtgtttcgtaaatacgggcaagagtatggagaccttaccaccccaaacatc
tcataccagtactattcgtctgaagctgtttcagcggagagagctgctaaaggcagatgg
tccactgtcatatctgtctgctcagtgacctgcggcacaggcatccagaaaatcagtcag
cactgtgtggatgtgctcacactggagcgtctggaagatgagctctgcagatcatccccg
caagcaccagatcagctgcagccctgcttccagaccgactgcccacccagctgggaggtg
ggtgagtttggaccctgcagcgccccctgtggtgtgggagagcaggggcgctctgtcaca
tgtgtccagaagcagggtacagtgaaagtggagctgcctgactcggactgtgcacttgac
tcgaaaccccaaaccactgagacctgcaacccccaaatctgtcctgccagatggcaggtg
tctgagcctggcgagtgttcggctgtgtgtggacccggggaggctcagagaacagtgtcg
tgtgtacgctcccatcatggatctgattctgaggttgaccaaaacctgtgctctgaaccc
aaacccacagaacgcgttccctgtgtggtggacgtttgtcctgtcggctgggattcccaa
agagagcagatccatacggactcccatgtaatgccccgctccagaatgcttccggtttat
gtttggagtccagtgattggccagtgctcaaagacctgtgggaatggatctcagcaggtt
tggttctcttgtgtggatcaccaatcacgcctagaagtcccagagttcctttgtgatcga
accagtaaaccagagatgtacacccagccctgtagcccatcaaaatgtcctgctacgtgg
cgctacatgcagggcccgtgcagtgcgtcttgtggaggtggtgtagcgaagagagtcctg
tactgttcccagaggatggagggagcagacagaaacagggatctggtggtgggagaatct
gcttgtcagtctgtgaccagaccttcagaggtagtggagtgtaatactgaagcctgtcca
gccaggtggcaggcaggacagcagggcgactgttcggtgtcgtgcgggatgggtgtagct
gtcaggagtgtgcgctgtgttcagtacgaaggaggtatagagagggttgtggaggaggac
cggtgtgacccaggaatcaagcctcccatcactgcaccatgcttcacacaagtctgttcg
ttccactgggacgtgcatgagtggagtgagtgttcagtctcatgtggtgatgggatccag
tctcggaccgtgtcctgcataggcccatcccgccctcttcctgtcagtccctttctttgc
ctccacttacccaaacccatcaccatccaggcctgctatagtcctgactgttcctcagct
ctagacctccacaccagacccaacagcactcacatacagtcagagccccggagagaagag
gggacacagagaaccacaccagctccagctgtcagaatgacgaagatgaggaagagtttc
tcagccactgcagctccagcagatgtgatgaacagcaccataagcatgacaacagaacca
ccacagaccagtgtatgtggacgacttctgcttcaagactcaggaactattgatctgcgc
aacgtcactcagatgaggtgtatttttgctattggtcgacctcttgatgaggtcattcag
atcaaaatcctatccagcactcttaactgccggcagaaggagaacatcgccctgtatgac
agactcatcctgatgcggctctgtgagaggatgagcggtaaaacgctgaaatcaagatca
aatgtgctgctggtgcgtcagagccgcctggcccccgggaatggagtgctgctatattac
cagagtgtaaaaaacaaaaaaagccaccatggagagtgtgatgttcagctgttctctccg
tctggactcattgagaatccaatcaagagcgcagccaccgccgcctctaacactcagagc
tgtcgcgtgttcatcgacgctccgcctgctttcaggattcagatcagagcgtctttctgt
gctttcaggattcagatcagagcgctttctgtgctcaacaacaccgatacaaacttcaca
tacatactgattcgtgatgtggatgccttaaagacgaccatcttcagagggactcagctc
ttcctgtggagctcctcaggaagcagggctgaagtggaattccatggggagtaccagcaa
atcaagggcacgttcagggccgagtattcatacattaacccttctgaagagcaaccagtg
tag

DBGET integrated database retrieval system