KEGG   Cyprinus carpio (common carp): 109088420Help
Entry
109088420         CDS       T05134                                 

Gene name
oat
Definition
(RefSeq) ornithine aminotransferase, mitochondrial
Organism
ccar  Cyprinus carpio (common carp)
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-GeneID: 109088420
NCBI-ProteinID: XP_018958123
Position
Unknown
AA seq 184 aa AA seqDB search
MNSMKSLMSRVAPALSRAVHSGKRASSSAASRAEPAEHALTSEEVYAREDRYGAHNYHPL
PVALERGEAGNFWGRTMGAISSSTDPSSYEGFGPFMPGFELVPYNDVAALEIVSGVRGKG
LLNAIIIKETKDYDAWRVCLRLRDNGLLAKPTHGDIIRLAPPLIIKEDEVRECVDIISRT
ILSF
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcatgaagagtctgatgagccgcgtggcgcccgccctgagccgtgcagtgcat
tctgggaagcgcgcatcgtcctctgcggcgtcccgagccgagcctgcggagcatgcgctg
acgtcagaggaggtttacgcccgcgaggatcgatacggcgctcataactaccacccgctg
cccgtggcgctggagcgaggagaggcggggaacttctggggccggacgatgggggccatt
tccagctcgacggaccccagcagttacgagggtttcggtccgttcatgcctggatttgag
ctggtcccgtacaatgacgtcgctgcgctagagatcgtgagcggcgtccgcgggaaaggc
ctcctgaacgccatcatcatcaaagagaccaaagactatgacgcctggagggtgtgtctt
cgtctccgtgacaacggtctgttggccaagcccactcacggtgacatcatccgactagcc
ccgcccctcattataaaggaggatgaggtcagagagtgtgtggacatcatcagcaggacc
atcctgtccttctaa

DBGET integrated database retrieval system