KEGG   Cyprinus carpio (common carp): 109089042Help
Entry
109089042         CDS       T05134                                 

Definition
(RefSeq) nucleolar protein 58-like
  KO
K14565  nucleolar protein 58
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    109089042
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ccar03009]
    109089042
Ribosome biogenesis [BR:ccar03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    109089042
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NOP5NT Nop DUF3016 Cas_Cas1 DUF2247 HD_3 tRNA-synt_His
Motif
Other DBs
NCBI-GeneID: 109089042
NCBI-ProteinID: XP_018958709
Position
Unknown
AA seq 213 aa AA seqDB search
MLVLFETAAGYAIFKVLDEQKLQQVDSLWKEFETPEKANKVVKLKHFEKFQDTTEALAAA
TAMVEGKLGKSLKKVLKKVVAKEAHEQLAITDVKLGGVIKEKLNLSCVHSPAVAELMRGI
RNQMEGLITGLPAREISAMSLGLVHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY
IMRCREWYGWHFPELGKIITDNLAYCKSVRKIG
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgttagtgttatttgaaactgccgctggctatgccatcttcaaggtcctggatgaacag
aaactccagcaggtggacagcctgtggaaggagtttgagacgccagaaaaagccaacaaa
gttgtaaaactgaagcactttgagaagttccaggacacaacagaagctcttgcagcggcc
acggcgatggtggaggggaaattggggaaaagtctgaaaaaagttctcaagaaagttgtg
gccaaagaggctcatgagcagctggctatcactgatgtcaaactaggaggagtcattaag
gagaagctgaacctgagctgtgtgcacagccctgctgtagctgagctcatgagaggcatc
agaaaccagatggaggggcttatcacaggtcttcctgccagagagatcagtgccatgtct
ctcggtttggtccacagtctttcacggtacaagctgaagttcagcccagacaaggtggac
accatgattgttcaagccatttctctgctggatgatctggataaggagctcaataactac
atcatgcgctgcagggaatggtacggctggcacttcccagagcttggcaagatcatcaca
gataacctggcgtactgcaagagtgtccgcaagattggttag

DBGET integrated database retrieval system