KEGG   Cyprinus carpio (common carp): 109089082
Entry
109089082         CDS       T05134                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1-like
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ccar01002]
    109089082
Enzymes [BR:ccar01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     109089082
Peptidases and inhibitors [BR:ccar01002]
 Metallo peptidases
  Family M1
   109089082
SSDB
Motif
Pfam: ERAP1_C Peptidase_M1
Other DBs
NCBI-GeneID: 109089082
NCBI-ProteinID: XP_018958763
Position
Unknown
AA seq 622 aa
MTSVALLVNLIVLPIHLWAAVTPETTSFPTSTSGEPFPWNKMRLPDTVSPLHYHLLIHPN
LTSLDFTGMVRIQIEVHEIQISVYAVPEKIDQAEFALDFFKTILRLLMPFQGACILNMLR
EFLTPDAFKLGIVRYLKRYSYQNTVNSNLWESLTNVCDSDGLDEGRLKGDESCQRSVSHS
GASKWHSEDELDVKAMMETWTLQEGFPLIMVEVKGRQVRLSQERYLKSDDPSQTSSFLWH
VPLTYITSGSTTVHRFLLKTKTDVLYLPEEVDWIKFNVDMSGYYIVHYEGSGWDDLITLL
KRNHTELSSNDRASLINNAFQLVSVGKLPLDKALDLTLYLSKETEIMPVTQGFSELVPLY
KLMEKRDMVELENQMKGYILQLFRKLIDQQSWTDDGSVSQRMLRSYLLLFGCVRGHPPCV
STATQLFNQWRDSDGNMSLPNDVTMAVFSVGAQTEDGWEFLFEKYKESMYASMKSRIKMA
LTTSPLDHKLKWMMEQSLVGEVMKTQDLPYVVTSVSINPKAYKHAWDFLKANWDSLIKKF
DLGSPSVAHMVVGVTNQYSTREMLAEIRSFFSSLRAETGAELRCIQQALENIEENIRWMD
KNLPLLKAWLHRHYDQHKNTEL
NT seq 1869 nt   +upstreamnt  +downstreamnt
atgactagcgttgctctgcttgtgaatctcatagttttgcccattcacctctgggctgca
gtcactccagagaccacttcattccccacatcaaccagtggagaaccattcccatggaac
aagatgagacttccagacacagtatctcctcttcattaccatctccttatccaccccaac
ctcacaagtttagactttactggaatggtgcggatccaaattgaggtccacgaaattcag
atttcagtgtatgctgtgccagagaagatcgaccaggcagagtttgctctggactttttt
aaaaccattttacgattgttaatgccatttcagggggcttgtattctgaacatgctgaga
gagtttctgaccccagatgcttttaaactgggcattgtgagatacctaaaacgctacagt
taccagaatacggtcaatagtaacctgtgggaaagtctgaccaatgtatgtgactctgat
ggtctggatgaaggcagactgaagggtgatgagtcctgccagcgctcagtctcacactct
ggagcttctaaatggcactctgaggatgagctggatgttaaggctatgatggagacgtgg
acattgcaggagggctttccactcattatggtggaggtcaaaggtcgccaagtcagacta
agtcaagagcgttacctcaagagtgatgacccctcacaaacatccagtttcctgtggcac
gttccattgacttacattacaagcggctcaaccacagtgcaccgcttcctgcttaagaca
aaaacagatgttctgtatctgccggaggaggtggactggatcaagtttaatgtggacatg
agtggatattacattgtgcactatgagggttctggctgggatgacctgatcacgctgctc
aaacgcaatcatacagagctcagcagcaatgaccgggccagcctcatcaacaacgccttc
cagttggtcagtgttggtaagcttccgctggataaggctttagacctgaccctgtaccta
agcaaggaaactgagattatgccagtgacacagggcttcagtgagcttgtgcccctgtac
aaactgatggagaagagagacatggtggagctggagaaccagatgaagggctacatactg
cagctgttcaggaagctcatagaccagcagtcgtggactgatgatggctctgtgtctcag
aggatgctgcgcagctacctgctcctgttcggctgtgtgcggggtcatcctccctgtgtc
agcacagctacccagctcttcaaccagtggagggactcagatgggaatatgagtcttcct
aatgatgttactatggctgtgttttctgtgggtgcccagactgaggatggctgggaattc
ctgtttgagaagtacaaggaatctatgtacgcctccatgaagagtaggataaagatggcc
ctcacaaccagccctctcgatcacaagctaaaatggatgatggagcagagtctggtggga
gaggtgatgaagactcaggatctgccatatgttgtgacttcagtcagtataaatcctaag
gcctacaaacacgcatgggactttttaaaagcgaactgggactccctgattaagaagttt
gatcttggctcaccctctgtagcgcacatggtagtgggagtgaccaaccagtattccacc
agagaaatgctagctgagattcgtagtttcttcagttccttgcgggctgagaccggagca
gaattgagatgtattcagcaagccctggagaacattgaagagaacattcgctggatggac
aagaacctcccactactgaaggcctggctgcacagacactatgaccagcacaaaaataca
gagctgtga

DBGET integrated database retrieval system