KEGG   Cyprinus carpio (common carp): 109091123
Entry
109091123         CDS       T05134                                 

Definition
(RefSeq) probable aminopeptidase NPEPL1
  KO
K09611  probable aminopeptidase NPEPL1 [EC:3.4.11.-]
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ccar01002]
    109091123
Enzymes [BR:ccar01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     109091123
Peptidases and inhibitors [BR:ccar01002]
 Metallo peptidases
  Family M17: leucyl aminopeptidase family
   109091123
SSDB
Motif
Pfam: Peptidase_M17 Pdase_M17_N2
Other DBs
NCBI-GeneID: 109091123
NCBI-ProteinID: XP_018960458
Position
11
AA seq 524 aa
MANVLLEFKASAGDSEPQNRPVLIVGQLANLQQINWTQVKGKLQPVVTKEIWQAALASLN
PNPTDSCPLYLSFAAVAAIPSRVSRHNSPSSAHFLTRLVRTCLPAGNNRCIVIVCEHSDV
FASACAIARAFPLFTRRSASSRRKEKKHVTVEFVTVGQDSGPLEVSTLECLASAADGVRL
AARIVDSPCSEMNTDDFLKEIKAVGSELGITPTIIRGEELKQKGFGGIYGVGKAAPHPPA
LAVLSHTPSGATQTIAWVGKGIVYDTGGLSIKGKTTMPGMKRDCGGAAAVLGAFKATVKQ
VLIILSTKDYWLRNLSTLKVLTPVSGGLITSGQPKRLALYVSQIHPQRQFPQYISNILSL
VFSVFFNVCCFLLQGISTGKYHAAVMTNSEQWEAACVRAGRSSGDLAHPLVYCPELHFSE
FTSAVADMKNSVADRENAQSSCAGLFIGSHLGFDWPGIWVHVDIASPVHAGERATGFGVA
MLLALFGQASEDPLLNSVSPLGATTAKTASEDQMESDCKRRRLV
NT seq 1575 nt   +upstreamnt  +downstreamnt
atggcgaacgtactgctcgagttcaaggcttctgccggggactcggagccgcagaaccgc
ccggtcctcatcgtcggccagctcgccaacctgcaacagatcaactggacccaggtgaaa
gggaaactgcagccggtggtcaccaaagagatatggcaggcggctttggcttctctgaat
cccaaccctacggatagttgcccgctgtatttgagttttgcagccgtggccgctattccc
tcacgagtcagtcgtcacaacagcccatcatccgcacacttcctcacccgcctcgtccga
acctgcctgcctgccggcaacaaccgctgcattgtgatagtgtgcgagcactctgatgtg
tttgcgtcagcgtgtgccattgcccgagctttcccgctcttcacccgccgttcagcatct
tctcgcagaaaagagaagaagcacgtcactgtggagtttgtcactgtgggtcaggacagt
ggcccgctggaggtctccacactggagtgtcttgccagtgcggcggatggagttcgtctg
gctgctcgaatcgtggacagtccatgcagcgaaatgaatactgatgacttcctaaaggaa
atcaaagcagtgggcagtgaattaggcatcactccaactataattcgaggagaggaactg
aaacaaaagggctttggaggtatctatggagttggtaaagctgctccgcatcctcctgca
ttggctgtgctcagccacactccctcaggagccacacagaccattgcctgggtgggcaaa
ggcattgtctacgacaccggcggtctcagcatcaagggcaaaaccacaatgccaggaatg
aagagagactgtggaggagccgcagctgttttgggagcttttaaagctactgttaaacag
gtactgattattttgtccactaaagattactggctgagaaacttatctacattaaaggtg
ctaacccctgtttcgggtggtctgatcacaagtgggcagccaaaacggcttgcactttat
gtatctcaaatccatccacagcgacagtttccacaatacatatcaaacatcctgtctctt
gtgttttctgttttctttaatgtctgctgtttcctgctgcagggaatctccacggggaag
tatcacgctgctgtgatgaccaacagtgagcagtgggaagccgcttgtgtgagagcgggc
cgcagcagcggagacctggcacatcctctggtctactgccccgagcttcacttcagtgaa
ttcacctccgctgtggctgacatgaagaactctgtggcggaccgtgagaatgcgcagagc
tcctgtgctggcctcttcattggttctcatctgggttttgattggccaggcatttgggta
catgtggacatcgcttcaccagtccacgctggggagcgtgctactggtttcggtgtggcc
atgctcttggctctgttcggccaggcatctgaggaccccttgctcaactctgtgtccccg
ttgggtgccaccacagccaaaactgcctctgaagaccagatggagagtgactgcaagagg
aggagactcgtctaa

DBGET integrated database retrieval system