KEGG   Cyprinus carpio (common carp): 109091312Help
Entry
109091312         CDS       T05134                                 

Gene name
parp8
Definition
(RefSeq) poly [ADP-ribose] polymerase 8
  KO
K15258  poly [ADP-ribose] polymerase 6/8 [EC:2.4.2.30]
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    109091312 (parp8)
Enzymes [BR:ccar01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     109091312 (parp8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP ARTD15_N Spo12
Motif
Other DBs
NCBI-GeneID: 109091312
NCBI-ProteinID: XP_018960621
Position
11
AA seq 855 aa AA seqDB search
MGMCSRQERIQKDVDIVIQRCKAEKDCLFSDFRFSDSTFTFTYSKGPKRVSYSVHVSDDY
PDNTYVSNSENNDEVLVTRDPIPVIFHRIATEIRINNDATSCLSIRSKLQTDKNVCHYAI
EEDSEGDNDSEEFYYVGQVNYDGELHKHPQLEADLAAVRDLYGHHAVSLREYGAIDDVDI
DLHIDVTFLDEEIALAWDVIRSEPVIVRLHCSLTQYLNGPVPTVDVFQVSSKDRFGLGHQ
LKKVMQTFVTQQWKCQSKDKLISPHSKKLNERKVKSPLHIFSTLRRSPSYPPPGCVKSKK
KLKPEQDGMSKSHRLLRRTCSSTVKPEMDGCVGKSHKLLGNSLSSDPRMEQHQPLKQPHR
LLSRPCSTAVKPEDCPPLRPHRSSVAEPRCEHAAGSSDGGALKPHRLLGRACSGSVRTEE
LDGLKHHHRLLSRSYSSSTKMGKSDIFKEPVTESRRLSLTSGLIGILAPSLSSTPQPNFG
AKSIPVRDRGFLVQTMEYAEQRIPVLNEFCVVCDEPHVFQNGPMLRPTVCERELCVFAFQ
TLGVMNEAADEIATGAQVVDLLVSMCRSALESPRKVVIFEPYPSVVDPIDSQALAFNPRK
KDYDRVMRALDSIASIREMTQAPYLEIKKQMDKHDPLAHPLLQWVISSNRSHIVKLPVTR
QLKFMHTPHQFLLLSSPPAKESNFRAAKGLFGSTFAFHGSHIENWHSILRNGLVVASNTR
LQLHGAIYGIGIYLSPLSSISFGYSGMNKKQQKVASKDETAANKSNINLQSQKKGQNPQF
LQSRNLKCIALCEVITSPDLHKHGDIWVVPNTDHVCTRFFFVYEDGQVGDTSINTQDPGI
NREILRVIGNQTATG
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atggggatgtgttcaaggcaagagaggattcaaaaagacgtcgacatcgtaattcaaagg
tgtaaggcagaaaaagactgcctgttttctgactttcgattctccgactccacgttcacc
ttcacctactcaaaaggacctaaaagggtgtcctactctgttcatgtctctgatgattat
ccagataacacatatgtgtctaactctgaaaacaatgatgaagtgttagtcacaagggat
ccaataccagtgattttccacagaattgcaacagaaatacgcataaataacgatgccacc
agctgtctgtctattagatcaaaacttcaaaccgacaaaaacgtgtgccattatgctata
gaggaggattcagagggtgacaatgattcagaggagttctactatgtaggacaggtaaat
tatgatggagagcttcacaaacacccccagctggaggctgatttggcagccgtgagggac
ttatatggccatcatgcagtatctctcagggaatatggtgcaattgatgatgtggacatc
gacctacacattgatgtcactttcctagatgaggagattgcacttgcctgggatgtaatc
cggagtgaacctgttattgtgcggcttcactgctccctcacacagtatctgaatggacca
gttcccactgttgacgtgttccaagtgtcttcaaaagacagatttggacttgggcatcag
ttgaaaaaggtaatgcaaacctttgtcacacagcagtggaagtgtcagagcaaagataaa
ctcatcagcccacacagcaaaaagctaaacgagaggaaggtgaagtctcccctgcacatt
ttttcaactctacgcagatcccccagctaccctcctcctggctgtgtgaaaagcaaaaag
aagctcaaacctgagcaggatggcatgtcgaaatcccaccgtctgttacggcgaacatgc
tccagcacggtgaagccagaaatggacggctgcgtcggcaagtcgcacaagctcctgggc
aattccctctccagtgacccgcggatggagcaacatcagcccctcaagcaaccccaccgg
ctgctgtcgaggccctgctcgaccgctgttaaaccggaggactgcccgccgctgcggcct
catcggtcgagcgtggcagagcctcgctgtgaacacgctgctggcagtagcgatggcggt
gctttgaagccccaccggctcctgggccgcgcctgctcgggcagcgtgcgaactgaagag
ctggatggcctgaagcaccaccaccgtctgctcagcaggtcctactccagcagcaccaag
atggggaaaagcgacatctttaaagaacctgtcacggagagcagacgcctctcccttacc
tcagggctaatcggcatcctagccccatcactctcttccacacctcagccaaacttcgga
gccaaatccattccagtcagagacagaggtttccttgttcagactatggagtatgcagag
cagcgtatccctgtactgaatgagttctgtgtggtctgcgatgaacctcacgtgttccaa
aatggaccaatgctaagacccacagtgtgtgagagagagttatgtgtattcgccttccaa
acgttaggggtcatgaatgaggctgctgatgagattgccactggtgctcaggtggtagac
ctactggtctccatgtgtcgatctgcactggagtctccgaggaaagttgtcatttttgag
ccatatccctctgtggtggatcccattgactcacaagcacttgccttcaaccccaggaaa
aaggactacgaccgagtgatgagagcacttgacagtatcgcatctatcagagaaatgacc
caggctccatacctggagataaagaaacaaatggacaagcatgatcccctggctcaccca
ctgctgcagtgggtgatttccagtaaccgatcacacatagtgaagcttcctgttactaga
caactgaagttcatgcacacaccccatcagttcctgctgctcagtagtccgccagccaaa
gaatccaactttagagctgctaaaggcctctttgggagtacctttgctttccatggatca
cacatagaaaactggcactccattttgaggaatggtttggtcgtggcatcaaacacgagg
cttcagctccatggcgctatctatgggattggaatctatctcagtccattatcaagcata
tcctttggctactcagggatgaataaaaaacagcagaaagttgcttcaaaagatgaaact
gctgccaacaagtccaatattaatttgcagtcacagaagaaaggccagaacccgcagttt
ctgcagagccgcaacctgaaatgcatagccttatgtgaagttattacatctccagacctg
cacaagcatggggacatctgggtagttccaaatacagatcatgtctgcacacgttttttc
tttgtttatgaggacggacaggtaggtgacacaagtataaacacacaggaccctggcatt
aatagggagatcttgcgagtcatcggcaatcaaacggctactggatga

DBGET integrated database retrieval system