KEGG   Cyprinus carpio (common carp): 109091829Help
Entry
109091829         CDS       T05134                                 

Gene name
vps16
Definition
(RefSeq) vacuolar protein sorting-associated protein 16 homolog isoform X1
  KO
K20180  vacuolar protein sorting-associated protein 16
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109091829 (vps16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccar04131]
    109091829 (vps16)
Membrane trafficking [BR:ccar04131]
 Endosome - Lysosome transport
  Tethering complex
   CORVET complex
    109091829 (vps16)
   Hops complex
    109091829 (vps16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Vps16_C Vps16_N
Motif
Other DBs
NCBI-GeneID: 109091829
NCBI-ProteinID: XP_018961160
Position
11
AA seq 718 aa AA seqDB search
MGNEVSQSQVLETKIFHSPYGTGVAILTGALRFTLATNIDDIKLRRLPEVPGLQGAPSCW
AVLTQDRQSKVLVASGPHLFILDNTACTPVTPPGLSPQASSIVHMCVSFSYKYLALLTDS
GHVWMGTSNLKEKLSEVDTKIKGSPKQMAWCRRPKSQQPSAVVMWDGLLLVVGECKETIQ
YHLEDDSILVPELDGVRIISGTHHELLQEVPGACEEIFKIASMAPGALLLEAHKEYEKES
QKADEYLREIKEQSLLSEAVRQCVEAAGHEHEPETQKTLLRAASFGKCFLSNFPPEQFVS
MCKDLRVLNAVRDYTVGIPLSHTQFKQMTLQVLIDRLVYRKLYLLAIEVCRYLKTPEYQG
VSRVLKHWACYKVQQKEESDEVIAKAVSVKLADAAGISYSEIATKAYESGRTELAIKLLE
FEPRSGEQVPLLLKMKKSPLALSKAIESGDTDLVYTVVMYLKNELNRGDFFMMLRNQPVA
LSLYKQFCKHQEQETLKDLFNQDDDHEELGNFYVKASYKEQRLEARIAHLQSAVDEYYKA
KNEFSAKTTEDEMRLLRFQRKLEEEKDEQLVGFSLQDTMTTLLSVGLHKHAEQLYKDFRM
PDKRFWWLKLKALAEKEDWEELEKFSKSKKSPIGYLPFVEVCIKHHNKCEARKYVAKVSP
EQKVKAHLAVGDVEGAAEAAIERRNESEISTVLSRCSATTDHLLVERLNRAKATVPKK
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgggcaatgaagtttctcaaagtcaggtgctggagaccaagattttccattcgccgtat
gggacaggtgttgccatattgacaggtgccttgcgattcactttggccacaaacattgat
gacataaaattgaggcggttacctgaggttccaggtctacagggggcgccctcgtgctgg
gcagtcctgactcaggataggcaaagtaaagtgctggtggccagtggacctcatctgttc
atcttagacaatacagcttgcacacctgtgactcccccaggtctctctccacaagcgtcc
agtatagttcacatgtgtgtctcattcagttataagtatctggcgctcctcactgactct
ggccatgtgtggatgggcacgtcaaacctaaaggagaaactcagtgaggttgacaccaaa
atcaaaggttccccgaaacagatggcctggtgtcgcaggcccaagagtcagcagccatcg
gctgtggtaatgtgggatgggctgctcctagtggtgggagagtgtaaagaaacaattcag
taccatctggaggatgactcaattctggtgccagaactggacggggtccggatcatcagt
ggaacacaccacgagctgctgcaagaggtcccaggtgcatgcgaggagatctttaaaatt
gcctccatggctcctggagcactactgctagaggcacataaagaatatgagaaagagagt
cagaaggcagatgagtatctgagagagattaaagagcagagtctgctgagcgaggctgtg
aggcagtgtgtggaggccgccggacatgaacatgaacctgagacacagaaaacactcttg
agggcggcctcatttgggaagtgctttttgagtaattttcctccagagcagtttgtcagc
atgtgtaaagacctgcgggtgttgaatgcagtccgagattataccgtcggcattccactt
tcccacactcagtttaaacagatgaccttacaggtgctcatcgacagactggtgtatcgt
aaactctatctgctggctattgaggtttgccgctatttaaagactccagaatatcaggga
gtaagcagagtactcaaacactgggcctgctataaggtccagcagaaggaagaatcagat
gaagtcatagcaaaagctgtgagtgtgaagcttgcggatgctgctggaatctcctattct
gaaatcgccactaaagcatatgagagtggacgcacagagctcgccattaagttgttggag
tttgagcctcgctctggtgagcaggtcccactgctgttaaaaatgaagaaaagccctctg
gctttaagtaaagccattgagagtggagacacggacctcgtgtacacagtggtcatgtac
ctgaagaatgagctgaacagaggagacttcttcatgatgttgaggaaccaacctgtggct
ctgagcctctacaaacagttctgtaagcatcaggagcaagaaacactaaaagatcttttc
aatcaagatgatgatcatgaagaacttggcaatttctatgtaaaggccagctataaagaa
cagagactggaagctcggattgctcatttacaaagtgctgtggatgagtactacaaagcc
aagaatgaattttccgccaagacaacagaagatgaaatgcgtctgctgcggtttcagagg
aagctagaggaagagaaggatgagcagctcgtgggattctctcttcaagacactatgacc
acgctgctgtctgtgggactgcacaaacacgccgaacaactttacaaagacttcagaatg
cccgacaagaggttctggtggctgaagttgaaggctctggcagagaaggaggactgggaa
gagctggagaaattttccaaaagcaaaaagtctcctattggatatctgccatttgttgag
gtgtgcattaaacaccataacaaatgtgaagccaggaaatatgtggcaaaagtctcaccg
gagcagaaggtcaaagctcaccttgcagtgggggatgtggaaggtgccgcagaggctgct
atcgagaggcgtaatgaatcagagatcagtactgttctgtcacgctgttcagccaccact
gatcatcttctggtggaacgcctcaatcgtgctaaagccactgttcccaaaaagtga

DBGET integrated database retrieval system