KEGG   Cyprinus carpio (common carp): 109092037
Entry
109092037         CDS       T05134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: single-minded homolog 1-like
  KO
K09100  single-minded
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccar03000]
    109092037
Transcription factors [BR:ccar03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    109092037
SSDB
Motif
Pfam: PAS_3 PAS_11 PAS SIM_C HLH PAS_4 PAS_9
Other DBs
NCBI-GeneID: 109092037
NCBI-ProteinID: XP_018961305
Position
12
AA seq 412 aa
MKEKSKTAARTRREKENSEFYALARMLPLPSAITSQLDKASIIRLTSSYLKMRLVFPQGL
GEVWGRSRSLEHTNLELGSHLLQTLDGFIFVVAADGKIMYISETASVHLGLSQVELTGNS
IYEYVHPADHDEMTAVLTPPPSFHSHLIHEQEVERSFFLRMRCVLAKRNAGLTSGGYKVI
HCSGYLKTSVLDCYQNVGLVAVGHTLPPSAVTEIKLHSNMFMFRASLDMKLIFLDSRVSE
LTGYEPQDLIEKTLYHHVHSCDSFHLRCAHQLLLVKGQVTTKYYRFLSKHGGWVWVQSYA
TIXHNSRSSRPHCIVSVNYVLTDTEYKGVALSLDQLKPSRPAFPYREQHEPEDNPPASSS
RTQILVPPHSQQLSSFQPERSDSDRDSQWGGSPLTDSASPPRLDHSDTSEAA
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgaaggagaagtcaaagacggcggcgaggacgcggcgcgagaaagagaacagcgagttt
tacgcgctcgccagaatgttgccgttaccgtcggccatcacgtctcagctggacaaagcg
tccatcatccgactgaccagcagctacctgaagatgcgactggtgttcccgcaaggttta
ggtgaggtttggggtcgaagcagatctttagaacacacaaaccttgagctcggatctcat
ttactgcagacgttagacggctttatattcgtggtggctgcggatgggaagatcatgtac
atctcagagacggcgtcggttcatctgggcctttcacaggtagaactgaccgggaacagt
atttatgagtacgtccatccggccgatcacgacgagatgaccgcggttctgacccctccg
ccctcgttccactcacacctcatccacgagcaggaagtggagcgctcgttcttcttgaga
atgaggtgtgttttggccaaacgtaacgccggactgacgagcggaggatataaggtcatc
cactgcagcggctatctgaagacgtctgtgctggactgctatcagaacgtgggtctggtg
gcggtgggtcacactttacctcccagcgccgtcaccgagatcaagcttcacagcaacatg
ttcatgttcagagccagtctagacatgaagctcatcttcctcgactccagggtttcagag
ctgacaggatatgagccacaggacctgattgagaagaccctgtatcatcacgtgcacagc
tgtgacagctttcacctgcgctgcgctcatcagctcctgctggtcaaaggtcaggtgacc
actaaatattaccgcttcctgtccaaacacggcggctgggtttgggtgcagagttacgcc
acgattngtcacaacagccgctcgtctcgtccgcactgcatcgtcagcgtcaactacgtc
ctcacggacacagagtataaaggcgtggcgctgtctctggaccagctgaagcccagcaga
cctgcgttcccctacagagagcagcacgagccggaggacaaccctccagcgtcgagcagc
aggacccagatcctggttcctcctcactctcagcagttatcgtccttccagcctgagcgc
tcagattccgaccgcgacagccaatggggcggcagccctctgacagactccgcctccccg
ccgcgactggatcacagtgacacgtcagaagcagcctag

DBGET integrated database retrieval system