KEGG   Cyprinus carpio (common carp): 109092985
Entry
109092985         CDS       T05134                                 

Gene name
arnt2
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator 2 isoform X1
  KO
K15589  aryl hydrocarbon receptor nuclear translocator 2
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccar03000]
    109092985 (arnt2)
Transcription factors [BR:ccar03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    109092985 (arnt2)
SSDB
Motif
Pfam: PAS_3 PAS_11 PAS_9 PAS
Other DBs
NCBI-GeneID: 109092985
NCBI-ProteinID: XP_018962255
Position
13
AA seq 486 aa
MFFFRCGSAPLDHISLNRLSSMRKRYRNGLGPSKEGEAQYSVVHCTGYIKAWPPAGMTIP
DEDTEAGQTSKYCLVAIGRLQVTSSPVSMDMNGLSVPTEFLSRHNSDGIITFVDPRCINV
IGYQPQDLLGKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRMKNREWMLIRTSS
FTFQNPYSDEIEYIICTNTNVKQLQQQQQAELEVHQRDGLTAYDLSQVPVASVPAGVHDA
GKTIDKTDSLFSQERDPRFSDMYTGISGSDKKMMVPSSTAGGQQLYSQGSPFQPGHSGKS
FGSSVIHVPGVNDIQSTAGSAGQNLTQISRQINAGQVSWTGSRPPFSSQQQIPTQSSKAQ
SSPFGMGSSHSYQADPSSYSPLSSPATSSPSGNAYSNLGNRSNAFDVSAESSQSGGQFQS
RPSEVWSQWQSQHHSQQGGDPHPHPQSSQTEVFQDMLPMPGDPTQGTTNYNIEDFADLGM
FPPFSE
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgtttttttttaggtgtggcagtgctccactggatcatatctcactgaatcggttgtcc
agcatgagaaagagatacaggaatggtcttgggccgtctaaggagggggaggcgcagtac
tccgttgtgcactgtaccggctacatcaaggcctggccgccagcgggcatgaccattccg
gatgaagacacggaagcaggtcaaaccagcaaatactgcttggttgcaattggaagactg
caggtgaccagctctccagtttccatggatatgaacggactctctgtgccgacggagttc
ctttcccgccacaactcagatggcatcatcacttttgtggaccctcgttgcatcaacgtg
attggctaccagcctcaggatcttcttggcaaagacattttggagttctgccacccggag
gaccagagccacctgcgagagagcttccaacaggtggtcaagctgaaagggcaggttctc
tcggttatgtaccgcttccggatgaagaaccgagagtggatgctcatcagaaccagcagc
ttcaccttccagaacccttattcagacgagatcgagtacatcatctgcaccaacaccaat
gtcaagcagcttcagcagcaacagcaggccgagctggaggttcaccagagagacggactg
actgcttacgacctgtcacaggtgccggttgccagcgtcccagccggcgttcacgatgcg
ggcaaaaccattgacaaaaccgattcactgttctcgcaggagagagacccacgcttcagc
gacatgtacacgggcatctctggatctgataagaagatgatggtgccgtcctccactgct
ggtggacagcagttatactctcaaggcagcccgttccagcctggacactccggcaagagc
ttcggctcatctgtgatccacgtcccaggagtcaatgacatccagtccacagccggttca
gctggacagaacctgacccagatctcccggcagatcaacgccggccaggtgtcctggaca
ggaagcagacctcctttctccagccagcagcagattcccactcagtccagtaaagcccag
tcctcaccattcggcatgggctccagtcacagctaccaggccgacccgtcctcttacagc
cccctgtccagccccgccacctcctcgccctctggaaacgcctactccaatctgggcaat
cgcagcaatgctttcgatgtgtcggctgagagcagccagagcggaggacagttccagagc
cggccgtctgaggtctggtctcagtggcagagtcaacaccacagccagcagggaggagac
ccacatcctcatcctcagtccagccagaccgaggtcttccaggatatgctgccgatgccg
ggagatcccacccaaggaacaaccaattacaacatcgaagactttgccgacctcggcatg
ttcccgccgttctctgagtaa

DBGET integrated database retrieval system