KEGG   Cyprinus carpio (common carp): 109093946
Entry
109093946         CDS       T05134                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1-like
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ccar01002]
    109093946
Enzymes [BR:ccar01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     109093946
Peptidases and inhibitors [BR:ccar01002]
 Metallo peptidases
  Family M1
   109093946
SSDB
Motif
Pfam: ERAP1_C Peptidase_M1
Other DBs
NCBI-GeneID: 109093946
NCBI-ProteinID: XP_018963156
Position
14
AA seq 505 aa
MLREFLTPDAFKLGIVRYLKRYSYQNTVNSNLWESLTNVCDSDGLDEGRLKGDESCQRSV
SHSGASKWHSEDELDVKAMMETWTLQEGFPLIMVEVKGRQVRLSQERYLKSDDPSQTSSF
LWHVPLTYITSGSTTVHRFLLKTKTDVLYLPEEVDWIKFNVDMSGYYIVHYEGSGWDDLI
TLLKRNHTELSSNDRASLINNAFQLVSVGKLPLDKALDLTLYLSKETEIMPVTQGFSELV
PLYKLMEKRDMVELENQMKGYILQLFRKLIDQQSWTDDGSVSQRMLRSYLLLFGCVRGHP
PCVSTATQLFNQWRDSDGNMSLPNDVTMAVFSVGAQTEDGWEFLFEKYKESMYASMKSRI
KMALTTSPLDHKLKWMMEQSLVGEVMKTQDLPYVVTSVSINPKAYKHAWDFLKANWDSLI
KKFDLGSPSVAHMVVGVTNQYSTREMLAEIRSFFSSLRAETGAELRCIQQALENIEENIR
WMDKNLPLLKAWLHRHYDQHKNTEL
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgctgagagagtttctgaccccagatgcttttaaactgggcattgtgagatacctaaaa
cgctacagttaccagaatacggtcaatagtaacctgtgggaaagtctgaccaatgtatgt
gactctgatggtctggatgaaggcagactgaagggtgatgagtcctgccagcgctcagtc
tcacactctggagcttctaaatggcactctgaggatgagctggatgttaaggctatgatg
gagacgtggacattgcaggagggctttccactcattatggtggaggtcaaaggtcgccaa
gtcagactaagtcaagagcgttacctcaagagtgatgacccctcacaaacatccagtttc
ctgtggcacgttccattgacttacattacaagcggctcaaccacagtgcaccgcttcctg
cttaagacaaaaacagatgttctgtatctgccggaggaggtggactggatcaagtttaat
gtggacatgagtggatattacattgtgcactatgagggttctggctgggatgacctgatc
acgctgctcaaacgcaatcatacagagctcagcagcaatgaccgggccagcctcatcaac
aacgccttccagttggtcagtgttggtaagcttccgctggataaggctttagacctgacc
ctgtacctaagcaaggaaactgagattatgccagtgacacagggcttcagtgagcttgtg
cccctgtacaaactgatggagaagagagacatggtggagctggagaaccagatgaagggc
tacatactgcagctgttcaggaagctcatagaccagcagtcgtggactgatgatggctct
gtgtctcagaggatgctgcgcagctacctgctcctgttcggctgtgtgcggggtcatcct
ccctgtgtcagcacagctacccagctcttcaaccagtggagggactcagatgggaatatg
agtcttcctaatgatgttactatggctgtgttttctgtgggtgcccagactgaggatggc
tgggaattcctgtttgagaagtacaaggaatctatgtacgcctccatgaagagtaggata
aagatggccctcacaaccagccctctcgatcacaagctaaaatggatgatggagcagagt
ctggtgggagaggtgatgaagactcaggatctgccatatgttgtgacttcagtcagtata
aatcctaaggcctacaaacacgcatgggactttttaaaagcgaactgggactccctgatt
aagaagtttgatcttggctcaccctctgtagcgcacatggtagtgggagtgaccaaccag
tattccaccagagaaatgctagctgagattcgtagtttcttcagttccttgcgggctgag
accggagcagaattgagatgtattcagcaagccctggagaacattgaagagaacattcgc
tggatggacaagaacctcccactactgaaggcctggctgcacagacactatgaccagcac
aaaaatacagagctgtga

DBGET integrated database retrieval system