KEGG   Cyprinus carpio (common carp): 109094582
Entry
109094582         CDS       T05134                                 

Definition
(RefSeq) endothelial PAS domain-containing protein 1-like
  KO
K09095  hypoxia-inducible factor 2 alpha
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccar03000]
    109094582
   04131 Membrane trafficking [BR:ccar04131]
    109094582
Transcription factors [BR:ccar03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    109094582
Membrane trafficking [BR:ccar04131]
 Autophagy
  Pexophagy
   Other pexophagy associated proteins
    109094582
SSDB
Motif
Pfam: HIF-1a_CTAD HIF-1 PAS_3 PAS_11
Other DBs
NCBI-GeneID: 109094582
NCBI-ProteinID: XP_018963838
Position
15
AA seq 565 aa
MCSHVALFSPLPSLVCTKGQAVSAQYRMLAKNGGYVWVETQGTVIYNSRNSQPQCIVCVN
YVLSDVEEKSMVFSMDQTESLFKPQHLNRFFSPCKGGLGSEPGEVLFTKLKEEPEDLTQL
APTPGDTIISLDFGNSQYEKHPMYSSVSSVAPPVSHSVHDGHKTSYAGDIAKMAGTFSLP
QAPPPSSTTPSLSSCSTPSSPGDYYTSVDNDLKVELTEKLFSLDTQETKTSCNQKTDLSD
LDLETLAPYIPMDDEDFQLNPICPEEPSSETPRENNLGPDLGTNQQSFSNITSLFQPLSS
PSAARFQPNMSSGGDKQSISGGSVESWPSVPYNRGPMQMPPCHDPASTPLSSMGGRQNLQ
WPPDPPLPSKAGMMDPLAAKRSCQTVPANRMPPYLQRPMENFVQNYRDISPARLALANNF
KRSFTQMTMVLRRPPTKSQHTMWKRLRNESCAVMDRKSLSTSALSDKDMVHDGGMDHQHR
KTQYLMNQAGQATKHYREQCCNYREFNMQPSSKMNGIASRLIGASFENYFLPELTRYDCE
VNVPLQGNLHLLQGSDLIRALDQAT
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgtgttctcatgttgcactattttctcctcttccctcactagtgtgcactaaaggccag
gcggtgagcgctcagtacaggatgttggctaagaatgggggctatgtgtgggtggagacc
cagggtaccgtcatctacaacagtcgcaactcccagccccagtgcattgtgtgcgtgaac
tacgtgctgagtgacgtcgaggagaagtccatggtcttctctatggaccagactgagtct
ctgttcaagcctcagcacttgaaccgtttcttcagtccatgcaaaggcggcttgggcagt
gagccaggagaagtgctcttcaccaaactcaaagaggagcctgaagatctcacccagctg
gcacctacacctggtgacaccatcatctctcttgactttggtaactcccagtatgagaag
cacccgatgtacagcagtgtgtcttctgtggctcctcctgtctctcactctgttcatgac
ggccacaagacgagttatgctggagacattgccaagatggccggcactttctctctgcct
caggctccgcctcccagcagcacaactcccagcctgagcagctgctcgacgcccagcagc
cctggtgattactacacctcagtggacaatgacctgaaggtggagctgactgagaaacta
ttttccttggacacgcaagagacaaagacttcctgcaaccaaaagactgacttgagtgat
ctggacttggagactctggctccctacatccccatggatgatgaggacttccagctcaat
cccatctgcccggaggagccgtcatctgagacccctagagaaaacaatttaggaccagac
ttaggaaccaaccagcagagcttcagcaacatcacaagcctcttccagcccttgagttcc
ccttcagcagcccgcttccagcccaacatgagttcaggaggggataagcagagcatcagc
ggaggctctgtggagtcctggccatctgtaccctacaacaggggccccatgcagatgcct
ccctgccatgatcccgccagcaccccgctgtcctctatgggaggccgtcagaatctgcag
tggccgcctgaccctccgttacccagcaaggctggaatgatggatcctttagctgcaaag
cgctcttgccaaactgtgccagcaaatcgaatgccaccttatttgcaaaggcccatggag
aactttgtgcagaactacagagatataagtccagctcgacttgctctcgctaacaatttc
aagcgttcgttcacacagatgacaatggttttgagacgcccccccacaaaatcacaacac
acgatgtggaagagacttcgaaatgagagctgtgccgtcatggacaggaaatcactcagc
accagcgctttgtcagacaaagacatggtccatgatggaggtatggaccaccagcacagg
aagacccagtatttgatgaatcaggccggacaggcgacaaagcactatcgagaacagtgc
tgtaactacagagagttcaacatgcagccttcctccaaaatgaatggaattgcgagtcgt
cttataggggcctccttcgagaactactttctgcctgaactgacacgttacgactgcgag
gtcaacgtcccgttgcaaggcaatcttcatttgctgcagggcagtgacctcataagagca
ttagaccaggccacttag

DBGET integrated database retrieval system