KEGG   Cyprinus carpio (common carp): 109095058Help
Entry
109095058         CDS       T05134                                 

Definition
(RefSeq) CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase-like isoform X1
  KO
K00781  neolactotetraosylceramide alpha-2,3-sialyltransferase (sialyltransferase 6) [EC:2.4.99.6]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00514  Other types of O-glycan biosynthesis
ccar00515  Mannose type O-glycan biosynthesis
ccar00533  Glycosaminoglycan biosynthesis - keratan sulfate
ccar00601  Glycosphingolipid biosynthesis - lacto and neolacto series
ccar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    109095058
   00514 Other types of O-glycan biosynthesis
    109095058
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    109095058
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    109095058
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ccar01003]
    109095058
Enzymes [BR:ccar01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.6  N-acetyllactosaminide alpha-2,3-sialyltransferase
     109095058
Glycosyltransferases [BR:ccar01003]
 Terminal extension
  Sialyltransferase
   109095058
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 109095058
NCBI-ProteinID: XP_018964254
Position
16
AA seq 419 aa AA seqDB search
MKPAHKLLFVLCPMLVLGFIYYSSGKLHLHVWGQKPHKGVEPTVKVSKVTSVSVKTTVKT
TVTKEPVVEGPVSVGRIVGSGTASLQRVHSGQHENPSRPEFDKQGFLLNLDTKLPPELVY
KYGNLSEGSCKPGYAAAKMSAIYPKFNKPASMFLDRNFKRLAKVTNYLPPFGFKTQERII
DVILSTTKKYGLGPDLDSLSCKRCIIVGNGGILSNKSLGSRIDEYDVVIRLNEAPVSGYT
RDVGTKTTLRITYPEGAIQKTERYEKDSLFVFSAFKPLDFKWLRQMVFKEKLQGTEGFWK
SVAHFVPRQPSEIRILNPYFIQEAAFQFIGLPQNNGLMGKGNIPTLGTVAITMALHNCDE
VAVAGFGYDMNTPHAPLHYYETVKMSAIKESWTHNISKEKEFLHKLVKASIITDLTNGI
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctgcacacaaactactgttcgtcctgtgtcccatgctggtcttggggttcatc
tattactcttctgggaagctccatttgcacgtatggggccagaagccacataaaggtgtg
gagcccactgtaaaagtcagtaaagtcactagtgtttctgtcaaaaccactgtcaaaacc
actgtgaccaaagagccggtggtggagggccctgtctccgtgggacgaatagtaggctca
ggtacagcctcactgcaaagagtgcactctggtcaacatgagaaccccagcaggccggag
tttgataagcaagggttcttgctgaatctggacacaaagctgcctccggagttggtgtac
aagtacggaaaccttagtgaaggatcctgcaaacccggctatgcagcagccaaaatgagt
gctatctatccaaagtttaataagccagcttccatgtttctggaccgaaactttaagcga
cttgcaaaagttacaaactatttacctccatttggattcaaaacacaagaaagaatcata
gatgttatattatctaccacaaagaagtatggactgggtccagatttagatagtttgagt
tgtaaaagatgtataatagtaggtaatggcggtatccttagcaacaagtctttaggatcc
cgcattgatgaatatgacgttgtgataagactcaacgaggccccagtgagtggttacacc
agggatgtaggtactaagaccaccctgaggataacctatcccgaaggggccatccagaag
accgagcgctatgagaaagattccctctttgtcttctctgctttcaaacctcttgacttt
aaatggttgagacagatggtcttcaaagagaaactgcaaggaacagagggcttctggaag
tctgtagcgcactttgtgccccggcaaccctcggagatacggatcctcaacccctacttc
atacaagaggctgccttccagtttattggccttccacagaacaatggcctcatgggtaaa
gggaacattccaaccttaggcaccgttgccataacgatggcccttcataactgcgatgag
gttgctgttgctggatttggctatgacatgaacacccctcatgcacccctgcactactac
gaaacagtgaaaatgtctgccataaaagagtcatggactcacaacatctcaaaagaaaag
gagtttctccacaagttggtgaaggccagcattatcacagacttaaccaatgggatttga

DBGET integrated database retrieval system