KEGG   Cyprinus carpio (common carp): 109095159Help
Entry
109095159         CDS       T05134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: carnitine O-palmitoyltransferase 2, mitochondrial-like
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00071  Fatty acid degradation
ccar01212  Fatty acid metabolism
ccar03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109095159
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    109095159
Enzymes [BR:ccar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     109095159
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf DUF3077
Motif
Other DBs
NCBI-GeneID: 109095159
NCBI-ProteinID: XP_018964371
Position
16
AA seq 673 aa AA seqDB search
MSSCMMAGLISTHCKSTLSKFKRLRNNAALSVLTSTQRKYSSKDGAGIEYLHKSVVPTMH
YQKSLPRLPVPKLEDTIRRYLAAQRPLLNDEQYSNTEKVAHDFQSGVGKQLHEELVALDK
NNKHTSYISAPWFDMYLSARESVVLNFNPFMSFNPDPKPEYNDQLVRATNMVCSAVRFMK
TLRAGLLEPEVFHLNPAKSDTDSFKKLIRWVPPSISWFGAYMVNAYPLDMSQYFRLFNST
RIPKYKRDELLTDNKGHHLLVIKRGNLYVFDALDRDGNLIKPAEVQAHLKYILSDPTKTP
SFPLGVLTSENRDTWAGLRQKLLDAGNGAALHLVDSALFCLCLDEEVMRDHIHISHNMLH
GDGCNRWYDKSFSIILAKDGQAAINFEHSWGDGVAVLRFQNEVFKDTTEKPLVGPGSQPA
AVDSSSAVRRLEFKLTDELKAGITKXKENFQAAVSKLTIDAMEFKKGGKEQLKKKKLSPD
AISQLAFQMGFLRQYGQTVATYESCSTAAFKHGRTETIRPATIHTKRCAKAFVEQPGQHT
VEQLQGLLTECSKYHGQLTKEAAMGQGFDRHLFAMRYLANSKGMALHSLYQDPAYTAINH
NILSTSTLTSPAVSLGGFAPVVPDGFGVGYGVHDEWIGCNVSSYPARNVHEFLKCVHKSL
EDIFTVLDGKPIN
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagttgtatgatggcaggtttgatctctacgcattgtaagtcaacactgagcaaa
ttcaaacggttaagaaataacgctgccctctcagttctaacgagcactcagcgtaaatac
agcagtaaggatggagctgggattgagtatttacacaaaagtgtcgtcccgaccatgcac
taccagaagagtttaccaagattaccagttccaaaactggaagatacaatacggaggtat
ctggcagctcaaagacccctgctgaatgatgaacagtacagtaatacagagaaggtagcc
catgatttccagagtggtgtaggcaagcagttacatgaagaacttgtggccttagacaaa
aacaacaagcacaccagctatatatcagctccatggtttgacatgtacttgtctgctcgg
gagtctgttgtgctcaactttaaccccttcatgtcctttaaccctgaccccaaacccgag
tacaatgaccagcttgtgcgagccaccaacatggtgtgctcagccgtccggttcatgaag
acccttcgtgctggtctacttgagccagaggtgtttcatcttaaccctgccaagagtgac
actgatagtttcaagaagttgatccgatgggtgcccccctctatctcatggtttggagcg
tacatggtgaacgcctatcctctggatatgtcccagtacttccgcctcttcaactccaca
cgtatacccaagtacaagcgcgacgagctcctcacagacaacaagggccaccacctgctc
gtaataaagcgaggcaacctgtatgtgtttgatgctctagatcgggatggcaacctgata
aagcctgctgaggttcaagctcatttgaaatacatcctatcagaccccacaaaaactcct
tcgttccccttgggcgttctaaccagtgagaatagagacacctgggcagggttaagacag
aaactactggacgctggaaatggagcagctttgcatttagtagacagtgctttgttctgc
ctctgcctggatgaggaggtgatgagagaccatattcacatttcccacaacatgcttcat
ggagacggctgcaaccgctggtatgacaagtccttcagtatcatcttagctaaagatgga
caggcagccatcaattttgagcactcttggggtgacggcgtggccgttcttcgcttccag
aatgaggtcttcaaggacaccacggagaagcctttggtggggcctggatcccagcctgca
gcggtggactcttcctctgctgtgcgccgattagagtttaaactcactgatgagttaaaa
gctggaatcacaaagncaaaagagaacttccaggccgccgtgtcgaagctcaccatcgat
gccatggagttcaagaaaggtggaaaggagcaacttaagaagaagaagctcagtccagat
gccatctctcagctggctttccagatgggcttcctacggcaatacggccagacggtcgcc
acatacgagtcgtgtagcactgcagcctttaaacatgggcgcacagaaaccatccgtccc
gctaccatccacacaaagcgctgtgccaaggcattcgtcgagcagcctggacagcacact
gtggagcagttacaggggctcttgactgaatgctccaaataccatgggcagctcactaaa
gaggcagcaatgggtcaaggctttgatcgccatctctttgccatgcgctacctggctaat
tcaaaaggaatggccctgcacagtctctaccaggatccagcatatactgccataaaccac
aacattctctccaccagtactcttaccagccccgcagtcagtctgggcggatttgctcca
gtggtgcctgatggtttcggagtgggctatggtgtccacgatgaatggatcggttgcaat
gtgtccagctaccctgccagaaatgttcatgagttccttaagtgtgttcacaagtccttg
gaagacatttttacagtacttgatggaaaacccattaattga

DBGET integrated database retrieval system