KEGG   Cyprinus carpio (common carp): 109095401Help
Entry
109095401         CDS       T05134                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-3 subunit-like
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04260  Cardiac muscle contraction
ccar04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109095401
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    109095401
   04261 Adrenergic signaling in cardiomyocytes
    109095401
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ccar04040]
    109095401
Ion channels [BR:ccar04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   109095401
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 109095401
NCBI-ProteinID: XP_018964690
Position
1
AA seq 318 aa AA seqDB search
MSVGLLFIGGVCVAASEFYKSRHNVILSAGIFFVSAGMFPHIDFYLIIYKWSQNYELFRQ
LSNIIGIIVYISSNAGDPNQSESKRSHWYGWSFYCGALSFIIAEIVGVLTVHLFIDTHRV
LRARSQRSLQSSTHSLQHRRSNSYRSRYRWRQGQSRSSDSRSREPSPASHRNDLGLYALG
RGPPTATHALAHNSLGSGHGIAHFHNSVITNNNFANPHVFTMQNSVKSERELPHIQNSLS
TVKRFVFANAHEHNSVKLDNGVVLSQNYKLNSVNPSKSPVHEHNSGNDNSNAVKEPSYMP
QSGTATRRTTPVVKKRMV
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgggactgctgttcattggtggagtgtgtgtagccgccagtgagttctacaaa
agccgacacaacgttatcctgagcgcaggcatcttttttgtctcagctggtatgttcccg
cacatagacttttacctgattatttataaatggagtcaaaattatgagctatttcgtcag
ctcagcaacatcattggcattatagtgtacatctcatccaacgctggtgaccccaaccag
agcgaatccaagcgcagtcactggtacggctggagcttctactgcggcgctctttccttc
atcatagcggagattgtaggcgtcctgaccgtgcacctgttcatcgacacacaccgtgtg
ttgagagcgcgttcacaacgctcactccaaagcagcacacattccctgcagcatcggcgc
tcgaacagctaccgttcccgctaccgctggaggcagggtcaaagccgctcgtcagactcc
cggtcgcgcgaaccttctccggccagtcacagaaacgacctcgggctttatgctctggga
cgcggaccaccaacagctacgcacgcgctcgcgcataactccctaggctctggccatggt
attgcacattttcataactccgtcatcactaataacaactttgcaaatcctcatgttttc
accatgcagaactcggtgaagtcggaaagagagcttccgcacatacagaactcgttgagc
accgtgaaaaggtttgtgtttgccaatgcacatgaacacaattcagtcaaactggataat
ggagtcgtgctgtcgcagaactataaattaaactcagtaaatcccagtaaaagcccagtg
catgagcacaattctgggaatgacaattccaacgctgtaaaagagccctcatatatgcct
caaagtggcactgcgacaagaagaacaactccggtagtaaaaaaaagaatggtttaa

DBGET integrated database retrieval system