KEGG   Cyprinus carpio (common carp): 109095793
Entry
109095793         CDS       T05134                                 

Definition
(RefSeq) ankyrin repeat domain-containing protein 53-like
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ccar03036]
    109095793
Chromosome and associated proteins [BR:ccar03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    109095793
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank_4 Ank Ank_3 Peptidase_A2_2
Other DBs
NCBI-GeneID: 109095793
NCBI-ProteinID: XP_018965003
Position
17
AA seq 212 aa
MTPLFQERHHGHSDRNVNKLGGHEGLSVLHIAALHGHLDCIELLLEADGSVDVNSSCPHG
RRPVHMVLSAQSRPNTHACLIYLLEHGAQINVSTDEGLTPLHLAAAEGLTDCTETLVRNG
ADILAQDKRGHTPLVLSRIWGHRLAARFLKDAMWRKDKQQGIKKSKQLHDLRQFQCCSVL
DLPHLGRSLKPDTSPWTEVAMHLAEELKPGHY
NT seq 639 nt   +upstreamnt  +downstreamnt
atgacgcctctttttcaggagagacaccatggacacagcgacagaaacgtcaacaaactc
ggtggtcatgagggtctcagtgtgcttcatatagcagctctacatggacatctggactgt
attgagctgctgctggaggccgatggttctgtggatgtgaatagcagttgtcctcatgga
cgcagacctgtacatatggtgctgagtgctcagagccgacccaacacacatgcctgtctc
atttacctgctggaacatggagcccagatcaatgtctccacagatgaaggactcactccg
ctgcatctggccgctgctgaaggtctcacagactgtacagagacgctagtgagaaacgga
gcagacatactcgctcaagacaagaggggtcacacacccctcgtcctctctaggatctgg
ggccacaggctcgctgccaggtttctgaaagatgccatgtggcgaaaagacaaacagcag
gggatcaagaaaagcaaacagctacatgatctccggcagttccagtgttgcagtgtgcta
gatctgcctcacttgggtcgctccctaaaaccagatacctcgccctggactgaggtggcc
atgcacctggccgaggagctgaagccaggacactattag

DBGET integrated database retrieval system